DSHP-1 Portable Inclinometer
Function:
Theinstrumentisasmallinstrumentusedtodetermineinclinationofborehole.Itissuitabletodeterminedipangleandazimuthangleinmulti-pointmodeinnon-magneticborehole,whichismorethan46mmindiameter.
Theinstrumentdeterminesdipangleandazimuthangleofboreholeusingleadhammerprincipleandmagnetneedledirectionprinciple.Thereadingofazimuthangleanddipanglecanbeobtainedfromcontrollingcase.
Theinstrumentissimple,andconvenienttobeoperated.Itiswiththesameaccuracywiththatoflargeboreinstrument.
TechnicalParameters:
(1)Measurementrange:4°~356°;
(2)Measurementerror:±4°(Whenthedipangleis3°~50°);
(1)Measurementrange:0~50°;
(2)Measurementerror:≤±30′;
(1)Controllingcase:300×210×85mm,1.5kg;
(2)Inclinometerprobe:Φ40×1260mm,6kg;
(3)Extendingtube:Φ40×570mm,2kg;
Send product request
Other supplier products
| DSHD-0131 Multifunctional Digital Control Electric Compaction Tester | Productintroduction: 1:TheinstrumentisdesignedandmadeasperT0131“CompactionTestStandard”intheIndustryStandardJTJ052SpecificationandTestM... | |
| DSHG-900 Portable Mining Analyzer | DSHG-900PortableMiningAnalyzerapplieshighperformancelargeareaSDD(SiliconDriftDetector)andgeometryoptimizeddesign,theyhavefastertestingspeedandlower... | |
| DSHD-268 Carbon Residue Tester (Conradson Method) | A:ProductIntroduction: DSHD-268CarbonResidueTesterisdesignedaccordingthenationalstandardofPeople’sRepublicofChinaGB/T268TestMethodforCarbo... | |
| DSHJ-1C Rotational Viscometer | Productstandard: TheinstrumentisdesignedandmadeasperT0625“AsphaltRotationViscosityTest(BrookfieldViscometerMethods)”intheIndustryStanda... | |
| LC210 Gas Chromatograph | Thechromatographsystemnewlydesignedwithhigh-performanceHPLC.Instrument(basemodel)isformedbythehigh-pressureinfusionpump,injectorseparationsystem,UV... |
Same products
| PHS‑25C Benchtop Digital pH Meter | Seller: Kelilong Electron Co.Ltd | Product Description: Equipped with BNC‑composite electrodes and power supplies adapt... | |
| PHS‑3C Automatic Calibration pH/Thermometer | Seller: Kelilong Electron Co.Ltd | Product Description: Equipped with BNC‑compatible combination electrodes and power s... | |
| KL‑016 Benchtop Digital pH Meter (Backlit Display) | Seller: Kelilong Electron Co.Ltd | Product Description: This instrument features a large‑screen digital display, extern... | |
| KL‑98 Professional Laboratory pH/ORP/Temperature Meter | Seller: Kelilong Electron Co.Ltd | Product Description: The PH‑98 Tester is an easy‑to‑operate, multi‑functional microp... | |
| KL‑03(I) Pen‑type High‑precision pH Meter | Seller: Kelilong Electron Co.Ltd | Product Description: This instrument is available in a variety of colors. Calibratio... |













