PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
 |
H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
 |
Outdoor Patio Shades | Seller: Duoyes Living Arts and Technology(Ningbo) Co.,Ltd. | Duoyes Outdoor Patio Shades, a classic and innovative category to keep individuals protected duri... |
 |
Outdoor Padded Sofas | Seller: Duoyes Living Arts and Technology(Ningbo) Co.,Ltd. | Aluminum + Padded Fabric, are the two essential elements for Duoyes outdoor sofa with cushionsCol... |
 |
Outdoor Ottomans | Seller: Duoyes Living Arts and Technology(Ningbo) Co.,Ltd. | Duoyes outdoor patio ottoman, designed as a seat with a soft top and variety of shapes, can be us... |
 |
Outdoor Modular Daybeds | Seller: Duoyes Living Arts and Technology(Ningbo) Co.,Ltd. | Duoyes Outdoor Modular Daybedis a collection that indicates the quality of our inspiration and in... |
 |
Outdoor Lifting Tables | Seller: Duoyes Living Arts and Technology(Ningbo) Co.,Ltd. | Duoyes Lifting Tables Collection, an innovation initiative from an ergonomics design, devotes to ... |
