PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
 |
Ten-Impeller Paddle Wheel Aerator | Seller: Taizhou Jinhu Mechanical & Electrical Co., Ltd. | Taizhou Jinhu Mechanical & Electrical Co., Ltd. offers the Ten-Impeller Paddle Wheel Aerator,... |
 |
Custom Flat Lollipop Production | Seller: Jiangsu Flying Dragon Food Machinery Co., Ltd. | Custom Flat Lollipop Production provides tailored machinery solutions for shaping, forming, and p... |
 |
custom electrical enclosures | Seller: 869600 | custom electrical enclosures When searching for , they are looking for a manufacturer who ca... |
 |
cnc precision machining service | Seller: 869600 | cnc precision machining service CNC Precision Machining Service Hebi Jin Hui Precision Mach... |
 |
Microcrystalline wax used for high end candle production | Seller: Syntop chemical Co.,Ltd. | The core industrial applications of microcrystalline wax primarily stem from its finer crystal st... |
