PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... | |
| PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... | |
| CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... | |
| L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... | |
| APETX2 | ASIC3 channels, APETx2 inhibits ASIC3 channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAS N0.: Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRY... |
Похожие товары
| Cable Wire Recycling Production Line | Продавец: Changzhou Optima Technology Co.,Ltd. | Cable Wire Recycling Production Line 1000kg Copper Wire Recycling Machines: The biggest ca... | |
| Small Cable Granulator and Separator | Продавец: Changzhou Optima Technology Co.,Ltd. | Small Cable Granulator and Separator : Small shape,1 phase power,grind and separate copper f... | |
| Turnkey service of tire recycling | Продавец: Changzhou Optima Technology Co.,Ltd. | Turnkey service of tire recycling At , we specialize in manufacturing advanced tire recyclin... | |
| Mobile Portable Tire Shredder | Продавец: Changzhou Optima Technology Co.,Ltd. | Mobile Portable Tire Shredder Mobile Portable Tire Shredder – A cost-effective soluti... | |
| Aluminum wire rod rewinding machine | Продавец: Changzhou Optima Technology Co.,Ltd. | Aluminum wire rod rewinding machine Basic Introduction 's is engineered with advanced Korea... |















