.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

ACETYL TETRAPEPTIDE 5(EYESERYL)
ACETYL TETRAPEPTIDE 5(EYESERYL) Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA...
PSALMOTOXIN 1
PSALMOTOXIN 1 ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ...
H3K9me2
H3K9me2 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
H3K36me2
H3K36me2 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
PALMITOYL TRIPEPTIDE 1(PAL GHK)
PALMITOYL TRIPEPTIDE 1(PAL GHK) Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY...
All supplier products

Same products

FT wax used for EVA-based hot melt adhesive
FT wax used for EVA-based hot melt adhesive Seller: Syntop chemical Co.,Ltd. Fischer-Tropsch wax is a commonly used performance modifier in hot melt adhesives, especially for...
high melting point FT wax improve the heat resistance of adhesives
high melting point FT wax improve the heat resistance of adhesives Seller: Syntop chemical Co.,Ltd. FischerTropsch wax is an alkane polymer produced from synthesis gas or natural gas via the Fische...
For hot melt adhesive high melting point FT WAX
For hot melt adhesive high melting point FT WAX Seller: Syntop chemical Co.,Ltd. The key advantage of high-melting-point Fischer-Tropsch wax in hot-melt adhesives stems from its ...
Diesel Injection Delivery Valve 1W6982 Diesel Injection Delivery Valve 19A
Diesel Injection Delivery Valve 1W6982 Diesel Injection Delivery Valve 19A Seller: China lutong Diesel Injection Delivery Valve 1W6982 Diesel Injection Delivery Valve 19AChris Diesel Injection...
High melting point FT wax used as plastic processing additives
High melting point FT wax used as plastic processing additives Seller: Syntop chemical Co.,Ltd. Due to its high purity, low oil content, narrow melting range, high hardness, and excellent therm...