.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

H3K4ME1
H3K4ME1 Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ...
H3K56AC
H3K56AC Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with acetylation K56 modification. SPECIFICATION OF H3K5...
KURTOXIN
KURTOXIN SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ...
PROFESSIONAL PEPTIDE SUPPLIER
PROFESSIONAL PEPTIDE SUPPLIER , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ...
MODIFIED HISTONE
MODIFIED HISTONE As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f...
Все товары поставщика

Похожие товары

Microcrystalline wax used for rubber plastic processing and modification
Microcrystalline wax used for rubber plastic processing and modification Продавец: Syntop chemical Co.,Ltd. Microcrystalline wax has a wide range of industrial applications, primarily in the areas of rubbe...
Microcrystalline wax 80A used for lubrication and demolding
Microcrystalline wax 80A used for lubrication and demolding Продавец: Syntop chemical Co.,Ltd. The core industrial applications of microcrystalline wax 80A are primarily focused on rubber prot...
Tyvek Flat Roll Pouch
Tyvek Flat Roll Pouch Продавец: Hopeway AMD Tyvek Flat Roll Pouch is designed for professional sterilization packaging, offering clean handli...
Industrial Warehouse Ceiling Fans
Industrial Warehouse Ceiling Fans Продавец: Hebei Windmax Power Technology Co., Ltd. Industrial Warehouse Ceiling Fans Industrial Warehouse Ceiling Fans for Warehouses, Logisti...
HVLS Ceiling Fan for Railway Station
HVLS Ceiling Fan for Railway Station Продавец: Hebei Windmax Power Technology Co., Ltd. HVLS Ceiling Fan for Railway Station for Railway Station All units are CE-certified, manufa...