.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.



Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

SEMAGLUTIDE AND IMPURITY
SEMAGLUTIDE AND IMPURITY Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which...
H3K4ME1
H3K4ME1 Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ...
H3K56AC
H3K56AC Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with acetylation K56 modification. SPECIFICATION OF H3K5...
PEPTIDE PRODUCTS
PEPTIDE PRODUCTS Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in...
NONAPEPTIDE 1
NONAPEPTIDE 1 Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
Все товары поставщика

Похожие товары

puff snacks machine
puff snacks machine Продавец: Jinan Shengrun Machinery Co., Ltd. Jinan SHENGRUN Machinery Co., Ltd. is a leading Chinese puffed and extruded food machinery manufa...
 Antigua and Barbuda
Antigua and Barbuda Продавец: Henan Tianzhidao Biological Technology Co., Ltd. Livestock frozen sperm storage liquid nitrogen tanks are the ultimate line of defence for guardin...
Turn Signal Switches
Turn Signal Switches Продавец: Guangzhou May Import & Export Trading Co.,Ltd The clockwise lever of the turn aftermarket signal light switchturns right, the counterclockwise ...
Tire-Pressure Monitoring System (TPMS)
Tire-Pressure Monitoring System (TPMS) Продавец: Guangzhou May Import & Export Trading Co.,Ltd The system has become a mandatory configuration for new vehicles throughout the United States and...
Special double head studs M6*25 45 Steam Turbine
Special double head studs M6*25 45 Steam Turbine Продавец: DONGFANG YOYIK (DEYANG) ENGNIEERING CO; LTD "Special double head studs M6*25 45 Steam Turbine Reheated steam vavle for Turbine generator part...