Ω AGATOXIN IVB
P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1
SPECIFICATION OF Ω AGATOXIN IVB
|
CAT |
C1060-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVB |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Water, or 0.9% NaCl solution |
|
Molecular weight |
5273 Da |
|
Molecular formula |
C215H337N65O70S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) |
APPLICATION OF Ω AGATOXIN IVB
ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels
As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more about modification of histones, please visit our website.
Send product request
Other supplier products
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
 |
APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
 |
Casting Grinding Balls | Seller: 869376 | Casting Grinding Balls , so called as Casting Grinding media balls,casting grinding steel ba... |
 |
Key Quality Factors in Food Contact Paper Production | Seller: Zhejiang Guanghe New Materials Co., Ltd. | Guanghe supplies food-grade parchment paper for commercial bakeries, food processors, restaurants... |
 |
Heat Sealing Sterilization Pouch | Seller: Hopeway AMD | Heat Sealing Sterilization Pouch is designed for secure medical instrument packaging, supporting ... |
 |
Catalytic Converter Scrap Supplier, Catalytic Converter Scrap for Sale, , Catalytic Converter Scrap, Catalytic Scrap for Sale, Catalytic Scrap Supplier, Scrap Catalytic Supplier | Seller: Trucont LLC | At Trucont LLC, we have ongoing Catalytic converter scrap available for immediate loading and shi... |
 |
Epimedium Extract | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ... |
