Ω AGATOXIN IVB

P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1

SPECIFICATION OF Ω AGATOXIN IVB

CAT	C1060-V
CAS NO.
Product Name	ωagatoxin IVB
Purity	> 98%
Form/State	Lyophilized powder
Solubility	Water, or 0.9% NaCl solution
Molecular weight	5273 Da
Molecular formula	C215H337N65O70S10
Source	Synthetic peptide
Storage	Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions	Up to two weeks at 4°C or three months at -20°C.
Sequence	EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46)

APPLICATION OF Ω AGATOXIN IVB

ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels

As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.

If you want to know more about modification of histones, please visit our website.

Other supplier products

	KURTOXIN	SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ...
	Ω AGATOXIN IVA	P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn...
	PALMITOYL PENTAPEPTIDE 4	Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
	H3K56AC	Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with acetylation K56 modification. SPECIFICATION OF H3K5...
	CALCISEPTINE	Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ...

供应产品

Same products

	Sucralose powder Food additive	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose, as a new generation of high-sweetness sweetener, has demonstrated comprehensive and ou...
	Sucralose Purchase price	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose, as a high-sweetness, calorie-free, and highly stable artificial sweetener, enjoys wide...
	Sucralose Partners, long-termCooperation	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is currently a widely used high-potency sweetener globally. Its safety has been verifie...
	Sucralose	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is a high-sweetness agent obtained by replacing the hydroxyl groups at positions 4, 1',...
	Sucralose	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is a trichloro derivative of sucrose (4,1',6'-trichloro-4,1',6'-dideoxy-galactosucrose)...