Ω AGATOXIN IVB

P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1

SPECIFICATION OF Ω AGATOXIN IVB

CAT	C1060-V
CAS NO.
Product Name	ωagatoxin IVB
Purity	> 98%
Form/State	Lyophilized powder
Solubility	Water, or 0.9% NaCl solution
Molecular weight	5273 Da
Molecular formula	C215H337N65O70S10
Source	Synthetic peptide
Storage	Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions	Up to two weeks at 4°C or three months at -20°C.
Sequence	EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46)

APPLICATION OF Ω AGATOXIN IVB

ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels

As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.

If you want to know more about modification of histones, please visit our website.

Other supplier products

	H3K79me2	As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
	PEPTIDE PRODUCTS	Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in...
	ACETYL HEXAPEPTIDE 3(ARGIRELINE)	ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas...
	UB AMC	UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U...
	H3K9me1	As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...

供应产品

Same products

	Sucralose powder Food additive	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose, as a new generation of high-sweetness sweetener, has demonstrated comprehensive and ou...
	Sucralose Purchase price	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose, as a high-sweetness, calorie-free, and highly stable artificial sweetener, enjoys wide...
	Sucralose Partners, long-termCooperation	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is currently a widely used high-potency sweetener globally. Its safety has been verifie...
	Sucralose	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is a high-sweetness agent obtained by replacing the hydroxyl groups at positions 4, 1',...
	Sucralose	卖方: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is a trichloro derivative of sucrose (4,1',6'-trichloro-4,1',6'-dideoxy-galactosucrose)...