PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... |
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
Похожие товары
 |
Microcrystalline wax used for rubber plastic processing and modification | Продавец: Syntop chemical Co.,Ltd. | Microcrystalline wax has a wide range of industrial applications, primarily in the areas of rubbe... |
 |
Microcrystalline wax 80A used for lubrication and demolding | Продавец: Syntop chemical Co.,Ltd. | The core industrial applications of microcrystalline wax 80A are primarily focused on rubber prot... |
 |
Tyvek Flat Roll Pouch | Продавец: Hopeway AMD | Tyvek Flat Roll Pouch is designed for professional sterilization packaging, offering clean handli... |
 |
Industrial Warehouse Ceiling Fans | Продавец: Hebei Windmax Power Technology Co., Ltd. | Industrial Warehouse Ceiling Fans Industrial Warehouse Ceiling Fans for Warehouses, Logisti... |
 |
HVLS Ceiling Fan for Railway Station | Продавец: Hebei Windmax Power Technology Co., Ltd. | HVLS Ceiling Fan for Railway Station for Railway Station All units are CE-certified, manufa... |
