PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
 |
H3K4me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Похожие товары
 |
Cable Wire Recycling Production Line | Продавец: Changzhou Optima Technology Co.,Ltd. | Cable Wire Recycling Production Line 1000kg Copper Wire Recycling Machines: The biggest ca... |
 |
Small Cable Granulator and Separator | Продавец: Changzhou Optima Technology Co.,Ltd. | Small Cable Granulator and Separator : Small shape,1 phase power,grind and separate copper f... |
 |
Turnkey service of tire recycling | Продавец: Changzhou Optima Technology Co.,Ltd. | Turnkey service of tire recycling At , we specialize in manufacturing advanced tire recyclin... |
 |
Mobile Portable Tire Shredder | Продавец: Changzhou Optima Technology Co.,Ltd. | Mobile Portable Tire Shredder Mobile Portable Tire Shredder – A cost-effective soluti... |
 |
Aluminum wire rod rewinding machine | Продавец: Changzhou Optima Technology Co.,Ltd. | Aluminum wire rod rewinding machine Basic Introduction 's is engineered with advanced Korea... |
