PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
MAMBALGIN 1 | ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
Похожие товары
 |
Cable Wire Recycling Production Line | Продавец: Changzhou Optima Technology Co.,Ltd. | Cable Wire Recycling Production Line 1000kg Copper Wire Recycling Machines: The biggest ca... |
 |
Small Cable Granulator and Separator | Продавец: Changzhou Optima Technology Co.,Ltd. | Small Cable Granulator and Separator : Small shape,1 phase power,grind and separate copper f... |
 |
Turnkey service of tire recycling | Продавец: Changzhou Optima Technology Co.,Ltd. | Turnkey service of tire recycling At , we specialize in manufacturing advanced tire recyclin... |
 |
Mobile Portable Tire Shredder | Продавец: Changzhou Optima Technology Co.,Ltd. | Mobile Portable Tire Shredder Mobile Portable Tire Shredder – A cost-effective soluti... |
 |
Aluminum wire rod rewinding machine | Продавец: Changzhou Optima Technology Co.,Ltd. | Aluminum wire rod rewinding machine Basic Introduction 's is engineered with advanced Korea... |
