SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
PEPTIDE PRODUCTS | Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in... |
Похожие товары
 |
High Quality Natural Stone Paint UV Resistant Weatherproof Exterior Coating | Продавец: Zhongshan Aisee Coating Co.,Ltd | PREMIUM NATURAL STONE PAINT – REAL STONE EFFECT COATING FOR EXTERIOR WALLS ✔ Stone-like ... |
 |
Powder coatings for automotive interior parts MT-A2201/MT-YN203GF | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2201 powders can be used ... |
 |
Powder coatings for Automotive trim parts MT-A2201/MT-YN218GF / | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2201 powders can be used ... |
 |
Powder coatings for Automotive trim parts MT-A2201 /MT-YZ108GF | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT- A2201 clearcoats can be u... |
 |
Powder coatings for Automotive trim parts MT-A2201/MT-YZ204I | Продавец: Standard International Group (HK) Limited | Product Description MT- A2201 clearcoats can be used for pillars and appliqués, roof rack... |
