APETX2

• 

ASIC3 channels, APETx2 inhibits ASIC3 channels1

SPECIFICATION OF APETX2

Product Name: APETx2

CAS N0.:

Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)

Purity: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 4561 Da

Molecular formula: C196H280N54O61S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF APETX2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.

More information about our peptide synthetic route, contact us.

Другие товары поставщика

	TYPES OF PEPTIDES FOR SALE	Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ...
	PALMITOYL TETRAPEPTIDE 7	Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
	PSALMOTOXIN 1	ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ...
	ACETYL HEXAPEPTIDE 3(ARGIRELINE)	The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th...
	H3K9ME3	Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ...

Похожие товары

	Sucralose Purchase price	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose, as a high-sweetness, calorie-free, and highly stable artificial sweetener, enjoys wide...
	Sucralose Partners, long-termCooperation	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is currently a widely used high-potency sweetener globally. Its safety has been verifie...
	Sucralose	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is a high-sweetness agent obtained by replacing the hydroxyl groups at positions 4, 1',...
	Sucralose	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is a trichloro derivative of sucrose (4,1',6'-trichloro-4,1',6'-dideoxy-galactosucrose)...
	Sucralose	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Thermal properties of SucraloseMelting point / Decomposition point: Approximately 125°C (deco...