APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Send product request
Other supplier products
 |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
 |
H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
 |
H3K9ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K9 modification. SPECIFICATION OF H... |
 |
Ω AGATOXIN IVB | P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI... |
Same products
 |
PakGent CL-F025P T25 Cell Culture Flask | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | PS, 25cm², TC treated. With a generous 25 cm² surface area, these T25 cell culture fla... |
 |
PakGent Cryogenic Boxes | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | Cryogenic boxes are special temperature-controlled storage containers used to store and transport... |
 |
PakGent STSS-509CG clear plastic tubes with end caps | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | Self standing, with O-ring, clear tube with green cap. The PakGent STSS-509CG clear plastic tube... |
 |
PakGent NMPB500A Brown Plastic Medicine Bottles | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | 500ml packaging bottle, amber. PakGent NMPB500A Brown Plastic Medicine Bottlesoffer secure sto... |
 |
PakGent PT-5000B-T Thermo Scientific Art Tips | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | Thermo pipette, clear, bulk pack. PakGent PT-5000B-T Thermo Scientific Art Tips offer precisio... |
