CALCICLUDINE
L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.
SPECIFICATION OF CALCICLUDINE
Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)
Purity: > 98%
Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Form/State: Lyophilized powder
Molecular weight: 6979
Molecular formula: C321H476N86O78S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCICLUDINE
Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.
As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
Похожие товары
 |
High Quality Natural Stone Paint UV Resistant Weatherproof Exterior Coating | Продавец: Zhongshan Aisee Coating Co.,Ltd | PREMIUM NATURAL STONE PAINT – REAL STONE EFFECT COATING FOR EXTERIOR WALLS ✔ Stone-like ... |
 |
Powder coatings for automotive interior parts MT-A2201/MT-YN203GF | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2201 powders can be used ... |
 |
Powder coatings for Automotive trim parts MT-A2201/MT-YN218GF / | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2201 powders can be used ... |
 |
Powder coatings for Automotive trim parts MT-A2201 /MT-YZ108GF | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT- A2201 clearcoats can be u... |
 |
Powder coatings for Automotive trim parts MT-A2201/MT-YZ204I | Продавец: Standard International Group (HK) Limited | Product Description MT- A2201 clearcoats can be used for pillars and appliqués, roof rack... |
