CALCICLUDINE
L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.
SPECIFICATION OF CALCICLUDINE
Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)
Purity: > 98%
Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Form/State: Lyophilized powder
Molecular weight: 6979
Molecular formula: C321H476N86O78S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCICLUDINE
Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.
As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... | |
| PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... | |
| APETX2 | ASIC3 channels, APETx2 inhibits ASIC3 channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAS N0.: Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRY... | |
| Ω AGATOXIN IVB | P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI... | |
| PROFESSIONAL PEPTIDE SUPPLIER | PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so... |
Похожие товары
| Hot Melt Adhesive for Vacuum Insulation Panels | Продавец: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Vacuum Insulation Panels Supply & Technical Support Capabilities ... | |
| Hot Melt Adhesive for Packaging | Продавец: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Packaging Bond Strength & Durability: Hot melt adhesives provide i... | |
| Hot Melt Adhesive for Hygiene Products | Продавец: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Hygiene Products refers to thermoplastic pressure‑sensitive adhesives ... | |
| LSAW Steel Pipe & Tube | Продавец: HEBEI TIRICO PIPELINE CO.,LTD | LSAW Steel Pipe & Tube , or Longitudinal Submerged Arc-Welding Pipe (also known as SAWL ... | |
| Anti-Corrosion Steel Pipe & Tube | Продавец: HEBEI TIRICO PIPELINE CO.,LTD | Anti-Corrosion Steel Pipe & Tube Anti-Corrosion Steel Pipe & Tube What Is an Anti... |















