CALCICLUDINE
L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.
SPECIFICATION OF CALCICLUDINE
Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)
Purity: > 98%
Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Form/State: Lyophilized powder
Molecular weight: 6979
Molecular formula: C321H476N86O78S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCICLUDINE
Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.
As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... |
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
Похожие товары
 |
PakGent CL-F025P T25 Cell Culture Flask | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | PS, 25cm², TC treated. With a generous 25 cm² surface area, these T25 cell culture fla... |
 |
PakGent Cryogenic Boxes | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Cryogenic boxes are special temperature-controlled storage containers used to store and transport... |
 |
PakGent STSS-509CG clear plastic tubes with end caps | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Self standing, with O-ring, clear tube with green cap. The PakGent STSS-509CG clear plastic tube... |
 |
PakGent NMPB500A Brown Plastic Medicine Bottles | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | 500ml packaging bottle, amber. PakGent NMPB500A Brown Plastic Medicine Bottlesoffer secure sto... |
 |
PakGent PT-5000B-T Thermo Scientific Art Tips | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Thermo pipette, clear, bulk pack. PakGent PT-5000B-T Thermo Scientific Art Tips offer precisio... |
