KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
CAT |
K1070-V |
CAS NO. |
|
Product Name |
Kaliotoxin |
Purity |
> 98% |
Form/State |
Lyophilized powder |
Solubility |
Soluble in water |
Molecular weight |
|
Molecular formula |
C171H283N55O49S6 |
Source |
Synthetic peptide |
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... | |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... | |
H3K4ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K4 modification. SPECIFICATION OF ... | |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... | |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
Похожие товары
H1650 6x50mL High Speed Centrifuge | Продавец: Hunan Xiang Yi Laboratory Instrument Development Co., Ltd. | H1650 Benchtop High Speed Centrifuge H1650 micro high speed centrifugewith angle rotor 24x1.5m... | |
Human/Canine/Porcine Insulin ELISA kit | Продавец: Bluegene Biotech | NE01I0004 Human/Canine/Porcine elisa insulin kit Human/Canine/Porcine elisa for insulinkit is ... | |
Human Collagen, Type I, Alpha 1 ELISA kit | Продавец: Bluegene Biotech | NE01C1899 Human Collagen, Type I, collagen 1 elisakit Human Collagen, type I, collagen type i ... | |
Human Chemokine (C-C motif) Ligand 18 ELISA kit | Продавец: Bluegene Biotech | Immunology NE01C0064 Human Chemokine (C-C motif) Ligand 18 ELISA Kit Human Chemokine (C-C mot... | |
Human C Reactive Protein ELISA kit | Продавец: Bluegene Biotech | NE01C0009 hs crp elisakit Human c reactive protein elisa kitis suitable for the detection of s... |