CALCISEPTINE

• 

Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.

SPECIFICATION OF CALCISEPTINE

Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)

Purity: > 98%(HPLC)

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 7167.40

Molecular formula: C304H477N91O88S11

Source: Chemical synthesis

Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCISEPTINE

Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.

KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.

Другие товары поставщика

	PALMITOYL PENTAPEPTIDE 4	Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
	H3K9ME3	Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ...
	H3K79me2	As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
	APETX2	ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ...
	L CARNOSINE	LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i...

Похожие товары

	Heat Sealing Sterilization Pouch	Продавец: Hopeway AMD	Heat Sealing Sterilization Pouch is designed for secure medical instrument packaging, supporting ...
	Catalytic Converter Scrap Supplier, Catalytic Converter Scrap for Sale, , Catalytic Converter Scrap, Catalytic Scrap for Sale, Catalytic Scrap Supplier, Scrap Catalytic Supplier	Продавец: Trucont LLC	В компании Trucont LLC мы постоянно предлагаем лом каталитических преобразователей для немедленно...
	Epimedium Extract	Продавец: Fruit Powder,Vegetable Powder	Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ...
	Pumpkin Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ...
	Broccoli Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who...