APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
|
CAT |
O1040-V |
|
CAS NO. |
|
|
Product Name |
APETx2 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4561 Da |
|
Molecular formula |
C196H280N54O61S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
Похожие товары
 |
Heat Sealing Sterilization Pouch | Продавец: Hopeway AMD | Heat Sealing Sterilization Pouch is designed for secure medical instrument packaging, supporting ... |
 |
Catalytic Converter Scrap Supplier, Catalytic Converter Scrap for Sale, , Catalytic Converter Scrap, Catalytic Scrap for Sale, Catalytic Scrap Supplier, Scrap Catalytic Supplier | Продавец: Trucont LLC | В компании Trucont LLC мы постоянно предлагаем лом каталитических преобразователей для немедленно... |
 |
Epimedium Extract | Продавец: Fruit Powder,Vegetable Powder | Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ... |
 |
Pumpkin Powder | Продавец: Fruit Powder,Vegetable Powder | Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ... |
 |
Broccoli Powder | Продавец: Fruit Powder,Vegetable Powder | Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who... |
