APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
|
CAT |
O1040-V |
|
CAS NO. |
|
|
Product Name |
APETx2 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4561 Da |
|
Molecular formula |
C196H280N54O61S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
CALCICLUDINE | L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam... |
Похожие товары
 |
PakGent CL-F025P T25 Cell Culture Flask | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | PS, 25cm², TC treated. With a generous 25 cm² surface area, these T25 cell culture fla... |
 |
PakGent Cryogenic Boxes | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Cryogenic boxes are special temperature-controlled storage containers used to store and transport... |
 |
PakGent STSS-509CG clear plastic tubes with end caps | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Self standing, with O-ring, clear tube with green cap. The PakGent STSS-509CG clear plastic tube... |
 |
PakGent NMPB500A Brown Plastic Medicine Bottles | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | 500ml packaging bottle, amber. PakGent NMPB500A Brown Plastic Medicine Bottlesoffer secure sto... |
 |
PakGent PT-5000B-T Thermo Scientific Art Tips | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Thermo pipette, clear, bulk pack. PakGent PT-5000B-T Thermo Scientific Art Tips offer precisio... |
