SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.
Send product request
Other supplier products
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
Same products
 |
H1650 6x50mL High Speed Centrifuge | Seller: Hunan Xiang Yi Laboratory Instrument Development Co., Ltd. | H1650 Benchtop High Speed Centrifuge H1650 micro high speed centrifugewith angle rotor 24x1.5m... |
 |
Human/Canine/Porcine Insulin ELISA kit | Seller: Bluegene Biotech | NE01I0004 Human/Canine/Porcine elisa insulin kit Human/Canine/Porcine elisa for insulinkit is ... |
 |
Human Collagen, Type I, Alpha 1 ELISA kit | Seller: Bluegene Biotech | NE01C1899 Human Collagen, Type I, collagen 1 elisakit Human Collagen, type I, collagen type i ... |
 |
Human Chemokine (C-C motif) Ligand 18 ELISA kit | Seller: Bluegene Biotech | Immunology NE01C0064 Human Chemokine (C-C motif) Ligand 18 ELISA Kit Human Chemokine (C-C mot... |
 |
Human C Reactive Protein ELISA kit | Seller: Bluegene Biotech | NE01C0009 hs crp elisakit Human c reactive protein elisa kitis suitable for the detection of s... |
