DSHD-265D-1 Kinematic Viscometer
-
A:Briefdescription:
DSHD-265D-1KinematicViscometerisappliedtodeterminethekinematicviscosityofliquidpetroleumproducts(Newtonliquid)underafixedtemperatureenvironmentasperGB/T265StandardTestMethodforKinematicViscosityandCalculationMethodforDynamicViscosityofPetroleumProductsandASTMD445.
B:Technicaladvantages
1.Theinstrumentisakindofspecially-madetestingmachinewhichthetemperaturecontrolaccuracycanreach±0.01℃andhavingdigitaldisplay.2.Itadoptshardglassvesselandheatpreservationcover(double-layervessel).Goodheatpreventionandeasytoobservethesample.3.Itadoptsdesktopandall-in-onemachinedesign,convenienttouse.4.Itadoptselectricstirrertoensuretheuniformofbathtemperature.
C:Technicalspecificationsandparameters1.Powersupply:AC220±10%50Hz.2.Heatingpower:Auxiliaryheater:1000W;TemperatureControlheater:600W.3.Powerforstirrer:6W,rotatingspeed:1200RPM4.Temperaturerange:ambient～100℃.5.Temperaturecontrolaccuracy:±0.01℃.6.Timer:0.0s~999.9s7.Constanttemperaturebath:20L,doublelayer.8.Ambienttemperature:-10℃～+35℃9.Relativehumidity:≤85％10.Totalpowerconsumption:nothigherthan1800W.11.Capillaryviscometer:7piecesintotal.Theinnerdiametersare0.6,0.8,1.0,1.2,1.5,2.0and2.5mm12.Overalldimension:530mm*400mm*670mm(waterbathisincluded)
-
Send product request
Other supplier products
 |
DSHD-17144 Carbon Residue Tester(Micro-method) | Productstandard:DSHD-17144CarbonResidueTester(Micro-method)isdesignedaccordingthenationalstandardofPeople’sRepublicofChinaGB/T17144TestMeth... |
 |
DSHD-0751 Emulsified Asphalt Consistency Tester | Productintroduction: DSHD-0751EmulsifiedAsphaltConsistencyTesterisdesignedanddevelopedasperT0751“EmulsifiedAsphaltSlurrySealMixtureConsistenc... |
 |
DSHX 200 Small Multi-channel XRF Spectrometer | Instrumentintroduction DSHX-200SmallMulti-channelX-RayFluorescenceSpectrometerfeaturesfor10fixedlightdiffractionchannels,10elementsbeinganalyzedsi... |
 |
LC210 Gas Chromatograph | Thechromatographsystemnewlydesignedwithhigh-performanceHPLC.Instrument(basemodel)isformedbythehigh-pressureinfusionpump,injectorseparationsystem,UV... |
 |
DSHY-10 Multifunctional Circulating Constant Temperature Water Bath | Productstandard: Theinstrumentisalaboratoryinstrumentspeciallydesignedandmadeforfactories,companies,constructioncompanies,researchinstitutes,andco... |
Same products
 |
FNAC-28 2 IN 1 Type-C USB Tester Voltage Current Power Meter | Seller: Phonefix | FNIRSI FNAC-28 Multifunctional 2 in 1 Type-C USB Tester Digital Voltmeter Ammeter Amperimetor Vol... |
 |
WF-EDU-02 Motor & Propeller Test Kit | Seller: Wing Flying Technologies Co., Ltd | WF-EDU-02 Motor & Propeller Test Kit Product Description Motor & Propeller Test Kitsare... |
 |
WF-EDU-01 Motor and Propeller Test Kit | Seller: Wing Flying Technologies Co., Ltd | WF-EDU-01 Motor and Propeller Test Kit Product Description Suggested Propulsion system ... |
 |
WF-EN-50 Engine Test Bench | Seller: Wing Flying Technologies Co., Ltd | Suggested Engine 110cc-350cc Engine Max Hanging Type Engine 20kg ... |
 |
WF-EN-15 Engine Test Bench | Seller: Wing Flying Technologies Co., Ltd | WF-EN-15 Engine Test Bench Product Description Suggested Engine 110cc Engine ... |
