AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)
CAS N0.:
Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)
Puriy: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 5202 Da
Molecular formula: C217H360N68O60S10
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.
Send product request
Other supplier products
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
 |
H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
Same products
 |
Heat Sealing Sterilization Pouch | Seller: Hopeway AMD | Heat Sealing Sterilization Pouch is designed for secure medical instrument packaging, supporting ... |
 |
Catalytic Converter Scrap Supplier, Catalytic Converter Scrap for Sale, , Catalytic Converter Scrap, Catalytic Scrap for Sale, Catalytic Scrap Supplier, Scrap Catalytic Supplier | Seller: Trucont LLC | At Trucont LLC, we have ongoing Catalytic converter scrap available for immediate loading and shi... |
 |
Epimedium Extract | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ... |
 |
Pumpkin Powder | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ... |
 |
Broccoli Powder | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who... |
