.

AGATOXIN IVA

P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.

SPECIFICATION OF Ω AGATOXIN IVA

Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)

CAS N0.:

Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide,bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)

Puriy: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 5202 Da

Molecular formula: C217H360N68O60S10

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF Ω AGATOXIN IVA

ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).

Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

L CARNOSINE
L CARNOSINE LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i...
H3K4ME1
H3K4ME1 Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ...
CALCICLUDINE
CALCICLUDINE L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam...
PALMITOYL TETRAPEPTIDE 7
PALMITOYL TETRAPEPTIDE 7 Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
H3K36me3
H3K36me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
Все товары поставщика

Похожие товары

Heat Sealing Sterilization Pouch
Heat Sealing Sterilization Pouch Продавец: Hopeway AMD Heat Sealing Sterilization Pouch is designed for secure medical instrument packaging, supporting ...
Catalytic Converter Scrap Supplier, Catalytic Converter Scrap for Sale, , Catalytic Converter Scrap, Catalytic Scrap for Sale, Catalytic Scrap Supplier, Scrap Catalytic Supplier
Catalytic Converter Scrap Supplier, Catalytic Converter Scrap for Sale, , Catalytic Converter Scrap, Catalytic Scrap for Sale, Catalytic Scrap Supplier, Scrap Catalytic Supplier Продавец: Trucont LLC В компании Trucont LLC мы постоянно предлагаем лом каталитических преобразователей для немедленно...
Epimedium Extract
Epimedium Extract Продавец: Fruit Powder,Vegetable Powder Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ...
Pumpkin Powder
Pumpkin Powder Продавец: Fruit Powder,Vegetable Powder Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ...
Broccoli Powder
Broccoli Powder Продавец: Fruit Powder,Vegetable Powder Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who...