AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)
CAS N0.:
Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)
Puriy: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 5202 Da
Molecular formula: C217H360N68O60S10
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... |
 |
H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
Похожие товары
 |
PakGent CL-F025P T25 Cell Culture Flask | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | PS, 25cm², TC treated. With a generous 25 cm² surface area, these T25 cell culture fla... |
 |
PakGent Cryogenic Boxes | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Cryogenic boxes are special temperature-controlled storage containers used to store and transport... |
 |
PakGent STSS-509CG clear plastic tubes with end caps | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Self standing, with O-ring, clear tube with green cap. The PakGent STSS-509CG clear plastic tube... |
 |
PakGent NMPB500A Brown Plastic Medicine Bottles | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | 500ml packaging bottle, amber. PakGent NMPB500A Brown Plastic Medicine Bottlesoffer secure sto... |
 |
PakGent PT-5000B-T Thermo Scientific Art Tips | Продавец: PakGent Bioscience (Suzhou) Co., Ltd. | Thermo pipette, clear, bulk pack. PakGent PT-5000B-T Thermo Scientific Art Tips offer precisio... |
