APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
|
CAT |
O1040-V |
|
CAS NO. |
|
|
Product Name |
APETx2 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4561 Da |
|
Molecular formula |
C196H280N54O61S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Send product request
Other supplier products
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Acetyl octapeptide 31(SNAP-8) Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
Same products
 |
Epimedium Extract | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ... |
 |
Pumpkin Powder | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ... |
 |
Broccoli Powder | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who... |
 |
Pomegranate Powder | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Pomegranate PowderLatin Name: Punica granatum linn.Used Part: Fruit juiceAppearance... |
 |
Orange Powder | Seller: Xi'an Yuensun Biological Technology Co., Ltd. | Product Name: Orange PowderLatin Name: Citrus sinensisUsed Part: Fruit juiceAppearance: Light yel... |
