APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
|
CAT |
O1040-V |
|
CAS NO. |
|
|
Product Name |
APETx2 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4561 Da |
|
Molecular formula |
C196H280N54O61S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Send product request
Other supplier products
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... |
 |
KURTOXIN | SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ... |
Same products
 |
Powder coatings for automotive interior parts MT-A2201/MT-YN203GF | Seller: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2201 powders can be used ... |
 |
Powder coatings for Automotive trim parts MT-A2201/MT-YN218GF / | Seller: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2201 powders can be used ... |
 |
Powder coatings for Automotive trim parts MT-A2201 /MT-YZ108GF | Seller: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT- A2201 clearcoats can be u... |
 |
Powder coatings for Automotive trim parts MT-A2201/MT-YZ204I | Seller: Standard International Group (HK) Limited | Product Description MT- A2201 clearcoats can be used for pillars and appliqués, roof rack... |
 |
Basecoat powder coating MT-A2204/MT-MW188I | Seller: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2204 basecoat comes in an... |
