APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
CAT |
O1040-V |
CAS NO. |
|
Product Name |
APETx2 |
Purity |
> 98% |
Form/State |
Lyophilized powder |
Solubility |
Soluble in water |
Molecular weight |
4561 Da |
Molecular formula |
C196H280N54O61S6 |
Source |
Synthetic peptide |
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Send product request
Other supplier products
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... | |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... | |
H3K4ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K4 modification. SPECIFICATION OF ... | |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... | |
H3K4me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
PakGent CL-F025P T25 Cell Culture Flask | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | PS, 25cm², TC treated. With a generous 25 cm² surface area, these T25 cell culture fla... | |
PakGent Cryogenic Boxes | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | Cryogenic boxes are special temperature-controlled storage containers used to store and transport... | |
PakGent STSS-509CG clear plastic tubes with end caps | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | Self standing, with O-ring, clear tube with green cap. The PakGent STSS-509CG clear plastic tube... | |
PakGent NMPB500A Brown Plastic Medicine Bottles | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | 500ml packaging bottle, amber. PakGent NMPB500A Brown Plastic Medicine Bottlesoffer secure sto... | |
PakGent PT-5000B-T Thermo Scientific Art Tips | Seller: PakGent Bioscience (Suzhou) Co., Ltd. | Thermo pipette, clear, bulk pack. PakGent PT-5000B-T Thermo Scientific Art Tips offer precisio... |