KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
|
CAT |
K1070-V |
|
CAS NO. |
|
|
Product Name |
Kaliotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C171H283N55O49S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Send product request
Other supplier products
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
H3K4me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
|
|
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
Same products
 |
KLUBER PETAMO GHY 133 N Grease for Placement Machine | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | NSK LR3 80G/PC 20PC,50PC/Carton NSK AS2 80G/PC 20PC,50PC/Carton ... |
 |
DL-Mevalonolactone CAS 674-26-0 Wholesale & Bulk | Seller: Wuhan Fortuna Chemical Co.,Ltd. | DL-Mevalonolactone CAS 674-26-0Wholesale & Bulk DL-Mevalonolactone is a chemical compound, s... |
 |
Cyclophosphamide CAS 50-18-0 Wholesale & Bulk | Seller: Wuhan Fortuna Chemical Co.,Ltd. | Cyclophosphamide CAS 50-18-0Wholesale & Bulk Cyclophosphamide is a medication used primarily... |
 |
Dydrogesterone CAS 152-62-5 Wholesale & Bulk | Seller: Wuhan Fortuna Chemical Co.,Ltd. | Dydrogesterone CAS 152-62-5Wholesale & Bulk Dydrogesterone is a synthetic progestogen, a typ... |
 |
Acriflavine Hydrochloride CAS 8063-24-9 Wholesale & Bulk | Seller: Wuhan Fortuna Chemical Co.,Ltd. | Acriflavine Hydrochloride CAS 8063-24-9Wholesale & Bulk Acriflavine hydrochloride is a chemi... |
