KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
|
CAT |
K1070-V |
|
CAS NO. |
|
|
Product Name |
Kaliotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C171H283N55O49S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... | |
| ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... | |
| APETX2 | ASIC3 channels, APETx2 inhibits ASIC3 channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAS N0.: Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRY... | |
| PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... | |
| ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
Похожие товары
| Easy-cleaning Silicone-Modified Waterborne UV Resin | Продавец: Guangzhou Human New Material Science and Technology Co., Ltd | LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d... | |
| Water-based Soft-Touch Resin for Consumer Electronics | Продавец: Guangzhou Human New Material Science and Technology Co., Ltd | Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve... | |
| Conformal Coatings | Продавец: Guangzhou Human New Material Science and Technology Co., Ltd | The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro... | |
| Metalized & Laser Transfer coating | Продавец: Guangzhou Human New Material Science and Technology Co., Ltd | Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ... | |
| Hydrophilic coatings for Air Conditioner | Продавец: Guangzhou Human New Material Science and Technology Co., Ltd | A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi... |
















