KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
|
CAT |
K1070-V |
|
CAS NO. |
|
|
Product Name |
Kaliotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C171H283N55O49S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
MARGATOXIN | SPECIFICATION OF MARGATOXIN CAT K1020-V CAS NO. Product Name Margatoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water... |
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
KURTOXIN | SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
Похожие товары
 |
Kluberoil Lamora D 220 30ml Original Oil | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | LAMORA Doils are used for the lubrication of slideways and guideways in modern machining centres,... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | TheLUBE SH-ONE-4Sis a special ureagreasedesigned for appropriatelubricationmanagement of machine ... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobilgrease 28resists water washing, provides superior load-carrying ability, reduces frictional ... |
 |
Kluber Isoflex Topas NCA 5051 50ml Original Lubricants | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | ISOFLEX TOPAS NCA 5051has a wide temperature range, is resistant to ageing and provides special c... |
 |
CHRISTO-LUBE MCG 111 2-OZ Valve Seal Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Non-reactive lubricant safe for aviation oxygen equipment. Great for use on O-Rings |
