KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
|
CAT |
K1070-V |
|
CAS NO. |
|
|
Product Name |
Kaliotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C171H283N55O49S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
Похожие товары
 |
Trimellitic anhydride 97% | Продавец: Yufeng International Group Co., Ltd | Trimellitic anhydrideis a 2-benzofuran compound having oxo groups at the 1- and 3-positions and a... |
 |
Isobutyric Anhydride CAS 97-72-3 | Продавец: Yufeng International Group Co., Ltd | Product Name: Isobutyric Anhydride CAS No.: 97-72-3 Purity: 99% Molecular Formula: C6H10O3 Mo... |
 |
Isobutyric Acid CAS 79-31-2 | Продавец: Yufeng International Group Co., Ltd | Product Name:ISOBUTYRIC ACID Synonyms: 2-Methylpropanoic acid 79-31-2 Isobutanoic acid 2-Met... |
 |
2-Amino-2-methyl-1-propanol（AMP）CAS：124-68-5 | Продавец: Yufeng International Group Co., Ltd | AtYufeng, a trusted 2-Amino-2-methyl-1-propanol Factory & Supplier, we prioritize quality and... |
 |
Dimethyl sulfoxide (DMSO) CAS: 67-68-5 | Продавец: Yufeng International Group Co., Ltd | Yufengis one of the leading dimethyl sulfoxide suppliers and also a professional such manufacture... |
