KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
|
CAT |
K1070-V |
|
CAS NO. |
|
|
Product Name |
Kaliotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C171H283N55O49S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
H3K36me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
Похожие товары
 |
Epimedium Extract | Продавец: Fruit Powder,Vegetable Powder | Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ... |
 |
Pumpkin Powder | Продавец: Fruit Powder,Vegetable Powder | Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ... |
 |
Broccoli Powder | Продавец: Fruit Powder,Vegetable Powder | Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who... |
 |
Pomegranate Powder | Продавец: Fruit Powder,Vegetable Powder | Product Name: Pomegranate PowderLatin Name: Punica granatum linn.Used Part: Fruit juiceAppearance... |
 |
Orange Powder | Продавец: Fruit Powder,Vegetable Powder | Product Name: Orange PowderLatin Name: Citrus sinensisUsed Part: Fruit juiceAppearance: Light yel... |
