SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
MARGATOXIN | SPECIFICATION OF MARGATOXIN CAT K1020-V CAS NO. Product Name Margatoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
Похожие товары
 |
Buy Ecstasy online/ Buy molly Online /Buy MDMA | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 BUY Ecstasy BUY molly BUY MDMA |
 |
SR-9009 (Stenabolic) Powder - SR-9009 Stenabolic Sarms Powder For Sale | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 Where To Buy Pure SR-9009 Powder. Buy Top ... |
 |
Pure ephedrine powder - Bulk ephedrine powder - Where to buy ephedrine powder | Продавец: 871344 | Message Whatsapp : +40 767 772 668contact Signal : Townrunner.01 Pure ephedrine powder Bulk... |
 |
BUY BENZODIAZEPINES AND RESEARCH CHEMICALS ONLINE | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 NB: All transactions between both parties remai... |
 |
5.4,4'-Oxydiphenol CAS 1965-09-9 | Продавец: Yufeng International Group Co., Ltd | Product Name: 4,4'-Oxydiphenol Synonyms: 4,4'-Dihydroxydiphenyl ether 4,4'-Oxydiphenol Bis(4-... |
