SPECIFICATION OF MAMBALGIN 1

Производитель: Hefei KS-V Peptide Biological Technology Co., Ltd.

Все товары поставщика

CAT	O1010-V
CAS NO.
Product Name	Mambalgin1
Purity	> 98%
Form/State	Lyophilized powder
Solubility	Soluble in water
Molecular weight
Molecular formula	C272H429N85O84S10
Source	Synthetic peptide
Storage	Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions	Up to two weeks at 4°C or three months at -20°C.
Sequence	LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38)

APPLICATION OF MAMBALGIN1

Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.

As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.

Отправить запрос, связаться с поставщиком

	CALCISEPTINE	Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ...
	SPECIFICATION OF MAMBALGIN 1	CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi...
	SHK TOXIN	Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig...
	PSALMOTOXIN 1	ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ...
	H3K4me3	As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...

Epimedium Extract	Продавец: Fruit Powder,Vegetable Powder	Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ...
Pumpkin Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ...
Broccoli Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who...
Pomegranate Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Pomegranate PowderLatin Name: Punica granatum linn.Used Part: Fruit juiceAppearance...
Orange Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Orange PowderLatin Name: Citrus sinensisUsed Part: Fruit juiceAppearance: Light yel...