SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... | |
| APETX2 | ASIC3 channels, APETx2 inhibits ASIC3 channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAS N0.: Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRY... | |
| H3K36me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... | |
| CALCICLUDINE | L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam... | |
| APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
Похожие товары
| Hot Melt Adhesive for Vacuum Insulation Panels | Продавец: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Vacuum Insulation Panels Supply & Technical Support Capabilities ... | |
| Hot Melt Adhesive for Packaging | Продавец: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Packaging Bond Strength & Durability: Hot melt adhesives provide i... | |
| Hot Melt Adhesive for Hygiene Products | Продавец: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Hygiene Products refers to thermoplastic pressure‑sensitive adhesives ... | |
| LSAW Steel Pipe & Tube | Продавец: HEBEI TIRICO PIPELINE CO.,LTD | LSAW Steel Pipe & Tube , or Longitudinal Submerged Arc-Welding Pipe (also known as SAWL ... | |
| Anti-Corrosion Steel Pipe & Tube | Продавец: HEBEI TIRICO PIPELINE CO.,LTD | Anti-Corrosion Steel Pipe & Tube Anti-Corrosion Steel Pipe & Tube What Is an Anti... |















