KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
|
CAT |
K1070-V |
|
CAS NO. |
|
|
Product Name |
Kaliotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C171H283N55O49S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Send product request
Other supplier products
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
Same products
 |
Kluberoil Lamora D 220 30ml Original Oil | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Our oils offer excellent lubricity also at low sliding speeds, enabling constant and precise feed... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Lubecorp part number 249250 is a 400ml bellows style cartridge often times used in autolube appli... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil grease 28is a high performance, antiwear grease. Available as a cartridge,2kgcan, 16kg pail... |
 |
Kluber Isoflex Topas NCA 5051 50ml Original Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | ISOFLEX TOPAS NCA 5051is a beige synthetic long homogeneous and short fiber. It consists of a syn... |
 |
CHRISTO-LUBE MCG 111 2-OZ Valve Seal Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Christo-Lube®MCG 111is a fully fluorinated grease thickened with PTFE which operates under ex... |
