KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
|
CAT |
K1070-V |
|
CAS NO. |
|
|
Product Name |
Kaliotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C171H283N55O49S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Send product request
Other supplier products
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
Same products
 |
Natamycin Bulk supply | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Proper storage of natamycin is crucial to ... |
 |
High quality Natamycin | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Agriculture ·Occasionally used to p... |
 |
Natamycin 7681-93-8 | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Medical Applications Natamycin is used as ... |
 |
Natamycin Manufacturer | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Food Industry Natamycin is widely used as ... |
 |
Natamycin Supplier | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！Welcome to inquire and book！ Natamycin is a natural antifungal agent and... |
