KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
|
CAT |
K1070-V |
|
CAS NO. |
|
|
Product Name |
Kaliotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C171H283N55O49S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Send product request
Other supplier products
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
Same products
 |
Castrol Molub-Allloy Paste TA 1KG High temperature Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | MOLUB-ALLOY™PASTE TAensures a good separating and sealing effect in high temperature and we... |
 |
Phenol Alkylation Plant | Seller: Hubei Sanli Fengxiang Technology Co., Ltd | Phenol Alkylation Plant Product Description Alkyl phenolis produced by the alkylation of phenol... |
 |
KYODO YUSHI PAREMAX SUPER 400G High Temperature Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KYODO YUSHIExtend Lubrication Life RMS-4VRare Max SuperGrease Cartridge (400g) for Bearings |
 |
Mobil CHASSIS GREASE LBZ 16KG Exhibits Excellent Flow even at very low tempe Eatures and in Long Pipelines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil Chassis Grease LBZis a semi-fluidgreasebased on synthetic oils in the consistency group NLG... |
 |
Mobil Velocite Oil No 6 Spindle Oil 16KG | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KLUBER ISOFLEX NBU15 KLUBER ISOFLEX NBU15 KLUBER ISOFLEX TOPAS NCA52 75G KLUBER ISOFLEX TOPAS ... |
