MAMBALGIN 1
ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2
SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN 1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us.
More information about our pre clinical trial, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
H3K9ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K9 modification. SPECIFICATION OF H... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
Похожие товары
 |
Castrol Molub-Allloy Paste TA 1KG High temperature Lubricants | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Clean application, Easy assembly and disassembly, Prevents fretting corrosion, Good separating ... |
 |
Phenol Alkylation Plant | Продавец: Hubei Sanli Fengxiang Technology Co., Ltd | Phenol Alkylation Plant Product Description Alkyl phenolis produced by the alkylation of phenol... |
 |
KYODO YUSHI PAREMAX SUPER 400G High Temperature Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Excellent in heat-resistance, water-resistance and EP property as well as mechanical stability, a... |
 |
Mobil CHASSIS GREASE LBZ 16KG Exhibits Excellent Flow even at very low tempe Eatures and in Long Pipelines | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil Chassis Grease LBZ je polotekuté plastické mazivo na bázi hydroxystear... |
 |
Mobil Velocite Oil No 6 Spindle Oil 16KG | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KLUBER MOLYKOTE EM-50L 1KG KLUBER MICROLUBE GBU-Y 131 1KG KLUBER CENTOPLEX GLP 500 1KG Kluber... |
