APETX2

• 

ASIC3 channels, APETx2 inhibits ASIC3 channels1

SPECIFICATION OF APETX2

Product Name: APETx2

CAS N0.:

Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)

Purity: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 4561 Da

Molecular formula: C196H280N54O61S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF APETX2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.

More information about our peptide synthetic route, contact us.

Другие товары поставщика

	ACETYL OCTAPEPTIDE 3/1(SNAP-8)	Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar...
	PLTX II	SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate...
	H3K4me3	As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
	PEPTIDE PRODUCTS	Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in...
	MAMBALGIN 1	ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ...

Похожие товары

	Easy-cleaning Silicone-Modified Waterborne UV Resin	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d...
	Water-based Soft-Touch Resin for Consumer Electronics	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve...
	Conformal Coatings	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro...
	Metalized & Laser Transfer coating	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ...
	Hydrophilic coatings for Air Conditioner	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi...