APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
Похожие товары
 |
Buy Ecstasy online/ Buy molly Online /Buy MDMA | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 BUY Ecstasy BUY molly BUY MDMA |
 |
SR-9009 (Stenabolic) Powder - SR-9009 Stenabolic Sarms Powder For Sale | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 Where To Buy Pure SR-9009 Powder. Buy Top ... |
 |
Pure ephedrine powder - Bulk ephedrine powder - Where to buy ephedrine powder | Продавец: 871344 | Message Whatsapp : +40 767 772 668contact Signal : Townrunner.01 Pure ephedrine powder Bulk... |
 |
BUY BENZODIAZEPINES AND RESEARCH CHEMICALS ONLINE | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 NB: All transactions between both parties remai... |
 |
5.4,4'-Oxydiphenol CAS 1965-09-9 | Продавец: Yufeng International Group Co., Ltd | Product Name: 4,4'-Oxydiphenol Synonyms: 4,4'-Dihydroxydiphenyl ether 4,4'-Oxydiphenol Bis(4-... |
