APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
MARGATOXIN | SPECIFICATION OF MARGATOXIN CAT K1020-V CAS NO. Product Name Margatoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... |
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Похожие товары
 |
Mobil DTE 832 ISO VG 32 208L Combined Cycle Turbine Oils | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil DTE832and 846 aresuperior performance turbine oilsdesigned for use in steam turbines, gas t... |
 |
MOBILUX EP 0 16KG Lithium Complex Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | This extreme pressure Grease has an NLGI Grade0comes in a 5-gallon bucket and weighs 38.53lbs. It... |
 |
Nisin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin, a natural antimicrobial peptide, has various applications in the food industry due to its ... |
 |
Nisin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin is considered a natural preservative because it is derived from the fermentation of bacteri... |
 |
Nisin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin is a natural antimicrobial peptide produced by certain strains of the bacterium Lactococcus... |
