APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
CALCICLUDINE | L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
H3K4ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K4 modification. SPECIFICATION OF ... |
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
Похожие товары
 |
The Ultimate Guide to Fluorescent Dye | Продавец: Axispharm | The Ultimate Guide to Fluorescent Dye Fluorescent dyes, also known as fluorophores, are compound... |
 |
KLUBER LECTRIC KR 44-102 1KG Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | NSK LR380G/PC 20PC,50PC/Carton NSK AS280G/PC 20PC,50PC/Carton NSK LG280G/PC 20PC,50PC/Carton N... |
 |
KLUBER ISOFLEX TOPAS NCA52 75G Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | “LUBE FS-2-7 700G” LUBE FS-2-4 400G LUBE FS-2-2 200G LUBE FS-1-7 700G LUBE MY-2-7... |
 |
mbbr media | Продавец: Hangzhou NIHAO Environmental Tech Co., Ltd | As a professional OEM factory and exporter of MBBR carriers, NIHAO MBBR carriers to many large en... |
 |
Kluber ISOFLEX TOPAS L 32CN 1KG Grease for Pick and Place Machine | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | NSK LR380G/PC 20PC,50PC/Carton NSK AS280G/PC 20PC,50PC/Carton NSK LG280G/PC 20PC,50PC/Carton N... |
