APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
Ω AGATOXIN IVB | P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI... |
 |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Похожие товары
 |
Procaine | Продавец: 862043 | CAS:59-46-1 |
 |
High Concentration Plastic Color Masterbatch Factory Direct Supply | Продавец: 861445 | We are a professional color masterbatch manufacturer with years of R&D experience in plastic ... |
 |
Acid Ink Blue G Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Ink Blue G Factory 【Application of Acid Ink Blue G 】 mainly used for making blue or ... |
 |
Acid Black ATT Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Black ATT Factory 【What’s Acid Black ATT】 is made of acid black 10B and acid o... |
 |
Acid Black 10B Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Black 10B Factory is mainly suitable for dyeing and printing wool ,silk and nylon fabri... |
