APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
Похожие товары
 |
Kluberoil Lamora D 220 30ml Original Oil | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | LAMORA Doils are used for the lubrication of slideways and guideways in modern machining centres,... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | TheLUBE SH-ONE-4Sis a special ureagreasedesigned for appropriatelubricationmanagement of machine ... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobilgrease 28resists water washing, provides superior load-carrying ability, reduces frictional ... |
 |
Kluber Isoflex Topas NCA 5051 50ml Original Lubricants | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | ISOFLEX TOPAS NCA 5051has a wide temperature range, is resistant to ageing and provides special c... |
 |
CHRISTO-LUBE MCG 111 2-OZ Valve Seal Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Non-reactive lubricant safe for aviation oxygen equipment. Great for use on O-Rings |
