APETX2

• 

ASIC3 channels, APETx2 inhibits ASIC3 channels1

SPECIFICATION OF APETX2

Product Name: APETx2

CAS N0.:

Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)

Purity: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 4561 Da

Molecular formula: C196H280N54O61S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF APETX2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.

More information about our peptide synthetic route, contact us.

Другие товары поставщика

	PSALMOTOXIN 1	ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ...
	APETX2	ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ...
	SYN AKE	Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve...
	MODIFIED HISTONE	As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f...
	PALMITOYL TRIPEPTIDE 1(PAL GHK)	Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY...

Похожие товары

	Epimedium Extract	Продавец: Fruit Powder,Vegetable Powder	Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ...
	Pumpkin Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ...
	Broccoli Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who...
	Pomegranate Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Pomegranate PowderLatin Name: Punica granatum linn.Used Part: Fruit juiceAppearance...
	Orange Powder	Продавец: Fruit Powder,Vegetable Powder	Product Name: Orange PowderLatin Name: Citrus sinensisUsed Part: Fruit juiceAppearance: Light yel...