PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... |
Похожие товары
 |
Micronized PP PE wax used for Injection Molding | Продавец: Syntop chemical Co.,Ltd. | The primary use of polypropylene micropowder wax is as a surface-modifying additive, mainly appli... |
 |
Marlboro red for sale / Wholesale Marlboro cigarettes | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 Marlboro red for sale Wholesale Marlboro ciga... |
 |
MEGA M-PR 3.1 ბლოკის და ბეტონის ქვაფენილის საწარმოო დანადგარის კომპლექტი | Продавец: VBM GLOBAL | |
 |
Micronized wax used for significantly improving wear resistance | Продавец: Syntop chemical Co.,Ltd. | Micro-powdered wax is a micron-sized wax powder additive primarily used to improve surface proper... |
 |
450ml Nanzhu Bamboo Coffee Handle Mug | Продавец: 865087 | The 450ml Nanzhu Bamboo Coffee Handle Mug from Yongkang Aijun Industry & Trade Co., Ltd. comb... |
