PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
CALCICLUDINE | L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam... |
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
Похожие товары
 |
Common Rail injector control valve F00V C01 365 & Common Rail injector control valve F00V C01 368 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 365 Common Rail injector control valve F00V C01 368 C... |
 |
Common Rail injector control valve F00V C01 362 & Common Rail injector control valve F00V C01 363 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 362 Common Rail injector control valve F00V C01 363 C... |
 |
Common Rail injector control valve F00V C01 358 & Common Rail injector control valve F00V C01 359 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 358 Common Rail injector control valve F00V C01 359 C... |
 |
Common Rail injector control valve F00V C01 355 & Common Rail injector control valve F00V C01 356 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 355 Common Rail injector control valve F00V C01 356 C... |
 |
Common Rail injector control valve F00V C01 352 & Common Rail injector control valve F00V C01 353 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 352 Common Rail injector control valve F00V C01 353 C... |
