PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... | |
| ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... | |
| H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... | |
| PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... | |
| PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
Похожие товары
| Microcrystalline wax as rust inhibitor | Продавец: Syntop chemical Co.,Ltd. | Microcrystalline wax is indeed one of the key ingredients in rust inhibitors. Thanks to its excel... | |
| Microcrystalline wax used in lubrication and sealing | Продавец: Syntop chemical Co.,Ltd. | Thanks to its high gel strength, strong adhesion, good flexibility, and excellent temperature res... | |
| нембутал | Пентобарбитал | Дигнитас | Пегасы в Европе | Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе | Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю... | |
| Цена на Нембутал в Испании | Цена на пентобарбитал в Италии | Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе | Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю... | |
| Купить пентобарбитал во Франции | Купить нембутал в Испании и Европе | Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе | Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю... |












