PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
|
|
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
Похожие товары
 |
YC160W Wheel excavator YC160W | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | YC160W Wheel excavator YC160W wheel excavator is a new generation of full hydraulic wheel excavat... |
 |
Yuchai U20 mini excavator | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Yuchai U20 mini excavator Improvements in Over 80 Details: Tailless Excavator U20 is a Yuchai ... |
 |
Yuchai YC80 small excavator | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Yuchai YC80 small excavator International brand engine It is equipped with Yanmar 4TNV98C natur... |
 |
Top Type Hydraulic Breaker | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Top Type Hydraulic Breaker With the higher restriction of blasting control,hydraulic breakeris w... |
 |
S35-Electric Skid Steer Loader | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | S35-Electric Skid Steer Loader Yuchai S35 Electric Skid Steer Loaderis compact and flexible, des... |
