PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... | |
| PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... | |
| NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... | |
| ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... | |
| H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Похожие товары
| FT wax used for EVA-based hot melt adhesive | Продавец: Syntop chemical Co.,Ltd. | Fischer-Tropsch wax is a commonly used performance modifier in hot melt adhesives, especially for... | |
| high melting point FT wax improve the heat resistance of adhesives | Продавец: Syntop chemical Co.,Ltd. | FischerTropsch wax is an alkane polymer produced from synthesis gas or natural gas via the Fische... | |
| For hot melt adhesive high melting point FT WAX | Продавец: Syntop chemical Co.,Ltd. | The key advantage of high-melting-point Fischer-Tropsch wax in hot-melt adhesives stems from its ... | |
| Diesel Injection Delivery Valve 1W6982 | Продавец: China lutong | Diesel Injection Delivery Valve 1W6982 Diesel Injection Delivery Valve 19AChris Diesel Injection... | |
| High melting point FT wax used as plastic processing additives | Продавец: Syntop chemical Co.,Ltd. | Due to its high purity, low oil content, narrow melting range, high hardness, and excellent therm... |













