PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PEPTIDE PRODUCTS | Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
Похожие товары
 |
C500-1.7 Series High Flow Multi-Stage Centrifugal Blower /Centrifugal Blower | Продавец: Greentech International (Zhangqiu) Co., Ltd | Greentech International (Zhangqiu) Co., Ltdis the professional blower supplier.Multistage Centrif... |
 |
Common Rail injector control valve F00VC01303 | Продавец: China Lutong Part Plant | Common Rail injector control valve F00VC01303 Tina#Stainless Steel Cylindrical Pin##Denso Common... |
 |
Common Rail injector control valve F00VC01200 | Продавец: China Lutong Part Plant | Common Rail injector control valve F00VC01200 Tina#Stainless Steel Cylindrical Pin##Denso Common... |
 |
Injector Control Valve Plate 24# | Продавец: China Lutong Part Plant | Injector Control Valve Plate 24# Tina#Stainless Steel Cylindrical Pin##Denso Common Rail Injecto... |
 |
Injector Control Valve Plate 12# | Продавец: China Lutong Part Plant | Injector Control Valve Plate 12# Tina#Stainless Steel Cylindrical Pin##Denso Common Rail Injecto... |
