PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... | |
| SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... | |
| Ω AGATOXIN IVB | P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI... | |
| CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... | |
| ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
Похожие товары
| YC160W Wheel excavator YC160W | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | YC160W Wheel excavator YC160W wheel excavator is a new generation of full hydraulic wheel excavat... | |
| Yuchai U20 mini excavator | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Yuchai U20 mini excavator Improvements in Over 80 Details: Tailless Excavator U20 is a Yuchai ... | |
| Yuchai YC80 small excavator | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Yuchai YC80 small excavator International brand engine It is equipped with Yanmar 4TNV98C natur... | |
| Top Type Hydraulic Breaker | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Top Type Hydraulic Breaker With the higher restriction of blasting control,hydraulic breakeris w... | |
| S35-Electric Skid Steer Loader | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | S35-Electric Skid Steer Loader Yuchai S35 Electric Skid Steer Loaderis compact and flexible, des... |
















