PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
UB AMC | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
Похожие товары
 |
Micronized polypropylene wax for injection moulding | Продавец: Syntop chemical Co.,Ltd. | The incorporation of polypropylene micronized wax into injection moulding processes delivers the ... |
 |
Drum Type Mobile Mixing Station | Продавец: Yousheng Machinery Equipment Co.,Ltd | Drum Type Mobile Mixing Station Drum Type Mobile Mixing StationPortable Drum Concrete Batch Plan... |
 |
Washable Cheap 13.56Mhz 213 Nfc Mini Stickers 13.56 Mhz RFID Label Sticker Tag HF/UHF Tags Dry Inlay | Продавец: XIUCHENG RFID | Size：On request Material:PET, PVC,paper or customized Frequency:UHF/HF Printing:Thermal transf... |
 |
Micronized wax used for industrial paint processing | Продавец: Syntop chemical Co.,Ltd. | Micronized wax is a vital functional additive in industrial paint processing, with primary functi... |
 |
Plant Growth Regulator Manufacturer | Продавец: HEBEI LAIKE BIOTECH CO.LTD | Plant Growth Regulator Manufacturer Plant Growth Regulator Manufacturer - Laike Biotech spec... |
