PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... |
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
Похожие товары
 |
10000L Bright Beer Tank | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 10000L Bright Beer Tank is often also called serving tank, tax determination tanks or clear beer ... |
 |
2000L Fermentation Tank | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 2000L Fermentation Tank is a Modular cylindrically-conical tank consist of a base tank (BT) and e... |
 |
300CPH(5CPM) Semi-Auto Beer Canning Machine | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 300CPH(5CPM) Semi-Auto Beer Canning Machine is specifically designed to beer filling and include ... |
 |
2000L 2 Vessel Copper Beer Brewing Equipment | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 2000L 2 Vessel Copper Beer Brewing Equipment , Copper has the highest heat conductivity, is easy ... |
 |
1000L 3 Vessel Beer Brewing Equipment | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 1000L 3 Vessel Beer Brewing Equipment is a brewery for restaurants, commecial and industrial brew... |
