.

CALCICLUDINE

L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.

SPECIFICATION OF CALCICLUDINE

Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)

Purity: > 98%

Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Form/State: Lyophilized powder

Molecular weight: 6979

Molecular formula: C321H476N86O78S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCICLUDINE

Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.

As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.


Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

NONAPEPTIDE 1
NONAPEPTIDE 1 Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
ACETYL OCTAPEPTIDE 3/1(SNAP-8)
ACETYL OCTAPEPTIDE 3/1(SNAP-8) Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar...
H3K9me1
H3K9me1 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
APETX2
APETX2 ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ...
PALMITOYL PENTAPEPTIDE 4
PALMITOYL PENTAPEPTIDE 4 Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
All supplier products

Same products

Blue Kingfisher Venetian Plaster Paint Wall Art Plaster Luxurious Texture
Blue Kingfisher Venetian Plaster Paint Wall Art Plaster Luxurious Texture Seller: Zhongshan Blue Kingfisher New Environmental Protection Materials Co., Ltd Product Overview Blue Kingfisher Venetian Plaster is a preferred artistic coating material for c...
Blue Kingfisher Velvet Texture Paint Interior Design High-end Wall Decoration Paint
Blue Kingfisher Velvet Texture Paint Interior Design High-end Wall Decoration Paint Seller: Zhongshan Blue Kingfisher New Environmental Protection Materials Co., Ltd Product Overview This is a paint that infuses emotion into a space. The soft, velvety matte surf...
Blue Kingfisher Liquid Granite Paint | High-Elasticity & Crack-resistant, Exterior Specialist Coating
Blue Kingfisher Liquid Granite Paint | High-Elasticity & Crack-resistant, Exterior Specialist Coating Seller: Zhongshan Blue Kingfisher New Environmental Protection Materials Co., Ltd Product Overview Blue Kingfisher High-Elasticity & Crack-resistant Liquid Granite Paint is...
Blue Kingfisher Easy-Renovation Velvet Cover Paint | Old Wall Makeover Magic Coating
Blue Kingfisher Easy-Renovation Velvet Cover Paint | Old Wall Makeover Magic Coating Seller: Zhongshan Blue Kingfisher New Environmental Protection Materials Co., Ltd Product Overview Tired of old walls? Blue Kingfisher Easy-Renovation Velvet Paint is your quic...
Ceramic Tile Cement for Commercial Spaces - High Efficiency, Wear-Resistant
Ceramic Tile Cement for Commercial Spaces - High Efficiency, Wear-Resistant Seller: Zhongshan Blue Kingfisher New Environmental Protection Materials Co., Ltd Product Overview Ceramic Tile Cement is a professional bonding material for commercial spaces li...