CALCICLUDINE
L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.
SPECIFICATION OF CALCICLUDINE
Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)
Purity: > 98%
Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Form/State: Lyophilized powder
Molecular weight: 6979
Molecular formula: C321H476N86O78S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCICLUDINE
Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.
As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.
Send product request
Other supplier products
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
 |
H3K36me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
Same products
 |
Hot Melt Adhesive for Vacuum Insulation Panels | Seller: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Vacuum Insulation Panels Supply & Technical Support Capabilities ... |
 |
Hot Melt Adhesive for Packaging | Seller: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Packaging Bond Strength & Durability: Hot melt adhesives provide i... |
 |
Hot Melt Adhesive for Hygiene Products | Seller: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Hygiene Products refers to thermoplastic pressure‑sensitive adhesives ... |
 |
LSAW Steel Pipe & Tube | Seller: HEBEI TIRICO PIPELINE CO.,LTD | LSAW Steel Pipe & Tube , or Longitudinal Submerged Arc-Welding Pipe (also known as SAWL ... |
 |
Anti-Corrosion Steel Pipe & Tube | Seller: HEBEI TIRICO PIPELINE CO.,LTD | Anti-Corrosion Steel Pipe & Tube Anti-Corrosion Steel Pipe & Tube What Is an Anti... |
