CALCICLUDINE
L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.
SPECIFICATION OF CALCICLUDINE
Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)
Purity: > 98%
Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Form/State: Lyophilized powder
Molecular weight: 6979
Molecular formula: C321H476N86O78S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCICLUDINE
Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.
As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.
Send product request
Other supplier products
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
MAMBALGIN 1 | ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
 |
KURTOXIN | SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ... |
Same products
 |
Kluberoil Lamora D 220 30ml Original Oil | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Our oils offer excellent lubricity also at low sliding speeds, enabling constant and precise feed... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Lubecorp part number 249250 is a 400ml bellows style cartridge often times used in autolube appli... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil grease 28is a high performance, antiwear grease. Available as a cartridge,2kgcan, 16kg pail... |
 |
Kluber Isoflex Topas NCA 5051 50ml Original Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | ISOFLEX TOPAS NCA 5051is a beige synthetic long homogeneous and short fiber. It consists of a syn... |
 |
CHRISTO-LUBE MCG 111 2-OZ Valve Seal Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Christo-Lube®MCG 111is a fully fluorinated grease thickened with PTFE which operates under ex... |
