.

CALCICLUDINE

L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.

SPECIFICATION OF CALCICLUDINE

Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)

Purity: > 98%

Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Form/State: Lyophilized powder

Molecular weight: 6979

Molecular formula: C321H476N86O78S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCICLUDINE

Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.

As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

PEPTIDE PRODUCTS
PEPTIDE PRODUCTS Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in...
 AGATOXIN IVA
AGATOXIN IVA P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna...
ACETYL HEXAPEPTIDE 3(ARGIRELINE)
ACETYL HEXAPEPTIDE 3(ARGIRELINE) The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th...
ACETYL OCTAPEPTIDE 3/1(SNAP-8)
ACETYL OCTAPEPTIDE 3/1(SNAP-8) Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar...
APETX2
APETX2 ASIC3 channels, APETx2 inhibits ASIC3 channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAS N0.: Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRY...
All supplier products

Same products

Silazanes
Silazanes Seller: Nanjing SiSiB Silicones Co., Ltd SiSiB SILICONES is a worldwide leading manufacturer of silanes and silicones for over 30 years. ...
Silanes & Siloxanes
Silanes & Siloxanes Seller: Nanjing SiSiB Silicones Co., Ltd SiSiB SILICONES is a leader ofsilicone gel manufacturers, and hasbeen producing silane coupling a...
RTV-2 Moding Silicone Rubber
RTV-2 Moding Silicone Rubber Seller: Nanjing SiSiB Silicones Co., Ltd SiSiB RTV-2 is a two-part, room-temperature curing silicone rubbers designed for mold-making. Si...
PU Foam Silicone Stabilizer
PU Foam Silicone Stabilizer Seller: Nanjing SiSiB Silicones Co., Ltd SiSiB develops and manufactures a full line of high-qualitysilicone oil surfactantfor formulating...
POWSIL-59223
POWSIL-59223 Seller: Nanjing SiSiB Silicones Co., Ltd POWSIL-59223 is an innovative textile softener, especially designed to deliver a hydrophilic, vo...