CALCICLUDINE
L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.
SPECIFICATION OF CALCICLUDINE
Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)
Purity: > 98%
Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Form/State: Lyophilized powder
Molecular weight: 6979
Molecular formula: C321H476N86O78S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCICLUDINE
Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.
As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... |
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K56ac | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
Похожие товары
 |
Natamycin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Proper storage of natamycin is crucial to ... |
 |
Natamycin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Agriculture ·Occasionally used to p... |
 |
Natamycin 7681-93-8 | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Medical Applications Natamycin is used as ... |
 |
Natamycin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Food Industry Natamycin is widely used as ... |
 |
Natamycin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！Welcome to inquire and book！ Natamycin is a natural antifungal agent and... |
