CALCICLUDINE

• 

L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.

SPECIFICATION OF CALCICLUDINE

Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)

Purity: > 98%

Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Form/State: Lyophilized powder

Molecular weight: 6979

Molecular formula: C321H476N86O78S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCICLUDINE

Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.

As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.

Другие товары поставщика

	APETX2	ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ...
	H3K4ME3	Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K4 modification. SPECIFICATION OF ...
	PROFESSIONAL PEPTIDE SUPPLIER	, Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ...
	PLECANATIDE	Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation...
	KALIOTOXIN	The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ...

Похожие товары

	Easy-cleaning Silicone-Modified Waterborne UV Resin	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d...
	Water-based Soft-Touch Resin for Consumer Electronics	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve...
	Conformal Coatings	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro...
	Metalized & Laser Transfer coating	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ...
	Hydrophilic coatings for Air Conditioner	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi...