CALCICLUDINE
L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1.
SPECIFICATION OF CALCICLUDINE
Product Name: Calcicludine (Calcicludine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)
Purity: > 98%
Solubility: Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Form/State: Lyophilized powder
Molecular weight: 6979
Molecular formula: C321H476N86O78S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCICLUDINE
Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons.
As a custom peptide company, we are your good choice. If you want to know more information about peptide library, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K56ac | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
H3K36me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
Похожие товары
 |
Kluberoil Lamora D 220 30ml Original Oil | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | LAMORA Doils are used for the lubrication of slideways and guideways in modern machining centres,... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | TheLUBE SH-ONE-4Sis a special ureagreasedesigned for appropriatelubricationmanagement of machine ... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobilgrease 28resists water washing, provides superior load-carrying ability, reduces frictional ... |
 |
Kluber Isoflex Topas NCA 5051 50ml Original Lubricants | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | ISOFLEX TOPAS NCA 5051has a wide temperature range, is resistant to ageing and provides special c... |
 |
CHRISTO-LUBE MCG 111 2-OZ Valve Seal Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Non-reactive lubricant safe for aviation oxygen equipment. Great for use on O-Rings |
