APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
|
CAT |
O1040-V |
|
CAS NO. |
|
|
Product Name |
APETx2 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4561 Da |
|
Molecular formula |
C196H280N54O61S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Send product request
Other supplier products
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
Same products
 |
Easy-cleaning Silicone-Modified Waterborne UV Resin | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d... |
 |
Water-based Soft-Touch Resin for Consumer Electronics | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve... |
 |
Conformal Coatings | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro... |
 |
Metalized & Laser Transfer coating | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ... |
 |
Hydrophilic coatings for Air Conditioner | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi... |
