APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
|
CAT |
O1040-V |
|
CAS NO. |
|
|
Product Name |
APETx2 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4561 Da |
|
Molecular formula |
C196H280N54O61S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Send product request
Other supplier products
 |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
Same products
 |
Castrol Molub-Allloy Paste TA 1KG High temperature Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | MOLUB-ALLOY™PASTE TAensures a good separating and sealing effect in high temperature and we... |
 |
Phenol Alkylation Plant | Seller: Hubei Sanli Fengxiang Technology Co., Ltd | Phenol Alkylation Plant Product Description Alkyl phenolis produced by the alkylation of phenol... |
 |
KYODO YUSHI PAREMAX SUPER 400G High Temperature Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KYODO YUSHIExtend Lubrication Life RMS-4VRare Max SuperGrease Cartridge (400g) for Bearings |
 |
Mobil CHASSIS GREASE LBZ 16KG Exhibits Excellent Flow even at very low tempe Eatures and in Long Pipelines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil Chassis Grease LBZis a semi-fluidgreasebased on synthetic oils in the consistency group NLG... |
 |
Mobil Velocite Oil No 6 Spindle Oil 16KG | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KLUBER ISOFLEX NBU15 KLUBER ISOFLEX NBU15 KLUBER ISOFLEX TOPAS NCA52 75G KLUBER ISOFLEX TOPAS ... |
