Ω AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
|
CAT |
C1050-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVA(ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A) |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
5202 Da |
|
Molecular formula |
C217H360N68O60S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34) |
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
As one of peptide synthesis suppliers, we have types of related products for sale, if you have needs, please contact us.
We have types of peptides synthesisproducts for sale, if you have needs, please leave us a message.
Send product request
Other supplier products
 |
MAMBALGIN 1 | ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
Same products
 |
Castrol Molub-Allloy Paste TA 1KG High temperature Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | MOLUB-ALLOY™PASTE TAensures a good separating and sealing effect in high temperature and we... |
 |
Phenol Alkylation Plant | Seller: Hubei Sanli Fengxiang Technology Co., Ltd | Phenol Alkylation Plant Product Description Alkyl phenolis produced by the alkylation of phenol... |
 |
KYODO YUSHI PAREMAX SUPER 400G High Temperature Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KYODO YUSHIExtend Lubrication Life RMS-4VRare Max SuperGrease Cartridge (400g) for Bearings |
 |
Mobil CHASSIS GREASE LBZ 16KG Exhibits Excellent Flow even at very low tempe Eatures and in Long Pipelines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil Chassis Grease LBZis a semi-fluidgreasebased on synthetic oils in the consistency group NLG... |
 |
Mobil Velocite Oil No 6 Spindle Oil 16KG | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KLUBER ISOFLEX NBU15 KLUBER ISOFLEX NBU15 KLUBER ISOFLEX TOPAS NCA52 75G KLUBER ISOFLEX TOPAS ... |
