SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.
Send product request
Other supplier products
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K56AC | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with acetylation K56 modification. SPECIFICATION OF H3K5... |
Same products
 |
Castrol Molub-Allloy Paste TA 1KG High temperature Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | MOLUB-ALLOY™PASTE TAensures a good separating and sealing effect in high temperature and we... |
 |
Phenol Alkylation Plant | Seller: Hubei Sanli Fengxiang Technology Co., Ltd | Phenol Alkylation Plant Product Description Alkyl phenolis produced by the alkylation of phenol... |
 |
KYODO YUSHI PAREMAX SUPER 400G High Temperature Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KYODO YUSHIExtend Lubrication Life RMS-4VRare Max SuperGrease Cartridge (400g) for Bearings |
 |
Mobil CHASSIS GREASE LBZ 16KG Exhibits Excellent Flow even at very low tempe Eatures and in Long Pipelines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil Chassis Grease LBZis a semi-fluidgreasebased on synthetic oils in the consistency group NLG... |
 |
Mobil Velocite Oil No 6 Spindle Oil 16KG | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KLUBER ISOFLEX NBU15 KLUBER ISOFLEX NBU15 KLUBER ISOFLEX TOPAS NCA52 75G KLUBER ISOFLEX TOPAS ... |
