SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.
Send product request
Other supplier products
 |
H3K36me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... |
Same products
 |
Mobil DTE 832 ISO VG 32 208L Combined Cycle Turbine Oils | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil DTE832and 846 aresuperior performance turbine oilsdesigned for use in steam turbines, gas t... |
 |
MOBILUX EP 0 16KG Lithium Complex Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | These lithium hydroxystearate greases are formulated to provide extra protection against wear, ru... |
 |
Nisin Direct supply | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin, a natural antimicrobial peptide, has various applications in the food industry due to its ... |
 |
Large supply Nisin | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin is considered a natural preservative because it is derived from the fermentation of bacteri... |
 |
Nisin Wholesale Price | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin is a natural antimicrobial peptide produced by certain strains of the bacterium Lactococcus... |
