SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.
Send product request
Other supplier products
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
Same products
 |
Kluberoil Lamora D 220 30ml Original Oil | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Our oils offer excellent lubricity also at low sliding speeds, enabling constant and precise feed... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Lubecorp part number 249250 is a 400ml bellows style cartridge often times used in autolube appli... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil grease 28is a high performance, antiwear grease. Available as a cartridge,2kgcan, 16kg pail... |
 |
Kluber Isoflex Topas NCA 5051 50ml Original Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | ISOFLEX TOPAS NCA 5051is a beige synthetic long homogeneous and short fiber. It consists of a syn... |
 |
CHRISTO-LUBE MCG 111 2-OZ Valve Seal Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Christo-Lube®MCG 111is a fully fluorinated grease thickened with PTFE which operates under ex... |
