SPECIFICATION OF MAMBALGIN 1
|
CAT |
O1010-V |
|
CAS NO. |
|
|
Product Name |
Mambalgin1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C272H429N85O84S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesisfor sale, if you have needs, please contact us.
Send product request
Other supplier products
 |
H3K56ac | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K4ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K4 modification. SPECIFICATION OF ... |
Same products
 |
Easy-cleaning Silicone-Modified Waterborne UV Resin | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d... |
 |
Water-based Soft-Touch Resin for Consumer Electronics | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve... |
 |
Conformal Coatings | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro... |
 |
Metalized & Laser Transfer coating | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ... |
 |
Hydrophilic coatings for Air Conditioner | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi... |
