Ω AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
|
CAT |
C1050-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVA(ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A) |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
5202 Da |
|
Molecular formula |
C217H360N68O60S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34) |
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
As one of peptide synthesis suppliers, we have types of related products for sale, if you have needs, please contact us.
We have types of peptides synthesisproducts for sale, if you have needs, please leave us a message.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
MARGATOXIN | SPECIFICATION OF MARGATOXIN CAT K1020-V CAS NO. Product Name Margatoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water... |
Похожие товары
 |
Buy Ecstasy online/ Buy molly Online /Buy MDMA | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 BUY Ecstasy BUY molly BUY MDMA |
 |
SR-9009 (Stenabolic) Powder - SR-9009 Stenabolic Sarms Powder For Sale | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 Where To Buy Pure SR-9009 Powder. Buy Top ... |
 |
Pure ephedrine powder - Bulk ephedrine powder - Where to buy ephedrine powder | Продавец: 871344 | Message Whatsapp : +40 767 772 668contact Signal : Townrunner.01 Pure ephedrine powder Bulk... |
 |
BUY BENZODIAZEPINES AND RESEARCH CHEMICALS ONLINE | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 NB: All transactions between both parties remai... |
 |
5.4,4'-Oxydiphenol CAS 1965-09-9 | Продавец: Yufeng International Group Co., Ltd | Product Name: 4,4'-Oxydiphenol Synonyms: 4,4'-Dihydroxydiphenyl ether 4,4'-Oxydiphenol Bis(4-... |
