Ω AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
|
CAT |
C1050-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVA(ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A) |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
5202 Da |
|
Molecular formula |
C217H360N68O60S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34) |
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
As one of peptide synthesis suppliers, we have types of related products for sale, if you have needs, please contact us.
We have types of peptides synthesisproducts for sale, if you have needs, please leave us a message.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
 |
Ω AGATOXIN IVB | P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI... |
Похожие товары
 |
The Ultimate Guide to Fluorescent Dye | Продавец: Axispharm | The Ultimate Guide to Fluorescent Dye Fluorescent dyes, also known as fluorophores, are compound... |
 |
KLUBER LECTRIC KR 44-102 1KG Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | NSK LR380G/PC 20PC,50PC/Carton NSK AS280G/PC 20PC,50PC/Carton NSK LG280G/PC 20PC,50PC/Carton N... |
 |
KLUBER ISOFLEX TOPAS NCA52 75G Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | “LUBE FS-2-7 700G” LUBE FS-2-4 400G LUBE FS-2-2 200G LUBE FS-1-7 700G LUBE MY-2-7... |
 |
mbbr media | Продавец: Hangzhou NIHAO Environmental Tech Co., Ltd | As a professional OEM factory and exporter of MBBR carriers, NIHAO MBBR carriers to many large en... |
 |
Kluber ISOFLEX TOPAS L 32CN 1KG Grease for Pick and Place Machine | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | NSK LR380G/PC 20PC,50PC/Carton NSK AS280G/PC 20PC,50PC/Carton NSK LG280G/PC 20PC,50PC/Carton N... |
