Ω AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
|
CAT |
C1050-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVA(ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A) |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
5202 Da |
|
Molecular formula |
C217H360N68O60S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34) |
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
As one of peptide synthesis suppliers, we have types of related products for sale, if you have needs, please contact us.
We have types of peptides synthesisproducts for sale, if you have needs, please leave us a message.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
Похожие товары
 |
Sucralose powder Food additive | Продавец: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose, as a new generation of high-sweetness sweetener, has demonstrated comprehensive and ou... |
 |
Sucralose Purchase price | Продавец: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose, as a high-sweetness, calorie-free, and highly stable artificial sweetener, enjoys wide... |
 |
Sucralose Partners, long-termCooperation | Продавец: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose is currently a widely used high-potency sweetener globally. Its safety has been verifie... |
 |
Sucralose | Продавец: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose is a high-sweetness agent obtained by replacing the hydroxyl groups at positions 4, 1',... |
 |
Sucralose | Продавец: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose is a trichloro derivative of sucrose (4,1',6'-trichloro-4,1',6'-dideoxy-galactosucrose)... |
