.

Ω AGATOXIN IVA

P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.

SPECIFICATION OF Ω AGATOXIN IVA

CAT

C1050-V

CAS NO.

Product Name

ωagatoxin IVA(ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

5202 Da

Molecular formula

C217H360N68O60S10

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)

APPLICATION OF Ω AGATOXIN IVA

ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).

As one of peptide synthesis suppliers, we have types of related products for sale, if you have needs, please contact us.

We have types of peptides synthesisproducts for sale, if you have needs, please leave us a message.



Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

ACETYL HEXAPEPTIDE 3(ARGIRELINE)
ACETYL HEXAPEPTIDE 3(ARGIRELINE) The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th...
CALCISEPTINE
CALCISEPTINE Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ...
PROTOXIN II
PROTOXIN II NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2...
CALCICLUDINE
CALCICLUDINE L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam...
PROFESSIONAL PEPTIDE SUPPLIER
PROFESSIONAL PEPTIDE SUPPLIER , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ...
Все товары поставщика

Похожие товары

K11 Flexible Waterproof Coating
K11 Flexible Waterproof Coating Продавец: Fujian Ruisen New Materials Co., Ltd. In recent years, with the improvement of people's living standard, the living conditions of the r...
Insulator & Electric Series
Insulator & Electric Series Продавец: Fujian Ruisen New Materials Co., Ltd. As a professional porcelain insulator suppliersand ceramic insulator suppliers, we offer differen...
Hollow & Bushing Insulator
Hollow & Bushing Insulator Продавец: Fujian Ruisen New Materials Co., Ltd. We offer different kinds of hollow porcelain insulator& Bushing Insulator for Substation, suc...
High Voltage Insulator Coating Series
High Voltage Insulator Coating Series Продавец: Fujian Ruisen New Materials Co., Ltd. High Voltage Insulator Coatings(HVIC) is used on excessive voltage insulators to forestall flasho...
Epoxy Zinc-Rich Primer
Epoxy Zinc-Rich Primer Продавец: Fujian Ruisen New Materials Co., Ltd. Instructions of Epoxy Zinc-Rich Primer It is two components epoxy zinc-rich primer heavy corro...