.

APETX2

ASIC3 channels, APETx2inhibits ASIC3 channels1

SPECIFICATION OF APETX2

CAT

O1040-V

CAS NO.

Product Name

APETx2

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4561 Da

Molecular formula

C196H280N54O61S6

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)

APPLICATION OF APETX2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.

If you want to know more details of Peptide CDMO, please leave us a message.



Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

ACETYL HEXAPEPTIDE 3(ARGIRELINE)
ACETYL HEXAPEPTIDE 3(ARGIRELINE) The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th...
MAMBALGIN 1
MAMBALGIN 1 ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ...
H3K56ac
H3K56ac As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
PLECANATIDE
PLECANATIDE Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ...
CALCISEPTINE
CALCISEPTINE Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ...
Все товары поставщика

Похожие товары

K11 Flexible Waterproof Coating
K11 Flexible Waterproof Coating Продавец: Fujian Ruisen New Materials Co., Ltd. In recent years, with the improvement of people's living standard, the living conditions of the r...
Insulator & Electric Series
Insulator & Electric Series Продавец: Fujian Ruisen New Materials Co., Ltd. As a professional porcelain insulator suppliersand ceramic insulator suppliers, we offer differen...
Hollow & Bushing Insulator
Hollow & Bushing Insulator Продавец: Fujian Ruisen New Materials Co., Ltd. We offer different kinds of hollow porcelain insulator& Bushing Insulator for Substation, suc...
High Voltage Insulator Coating Series
High Voltage Insulator Coating Series Продавец: Fujian Ruisen New Materials Co., Ltd. High Voltage Insulator Coatings(HVIC) is used on excessive voltage insulators to forestall flasho...
Epoxy Zinc-Rich Primer
Epoxy Zinc-Rich Primer Продавец: Fujian Ruisen New Materials Co., Ltd. Instructions of Epoxy Zinc-Rich Primer It is two components epoxy zinc-rich primer heavy corro...