APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
|
CAT |
O1040-V |
|
CAS NO. |
|
|
Product Name |
APETx2 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4561 Da |
|
Molecular formula |
C196H280N54O61S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
 |
CALCICLUDINE | L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam... |
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
Похожие товары
 |
Buy Ecstasy online/ Buy molly Online /Buy MDMA | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 BUY Ecstasy BUY molly BUY MDMA |
 |
SR-9009 (Stenabolic) Powder - SR-9009 Stenabolic Sarms Powder For Sale | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 Where To Buy Pure SR-9009 Powder. Buy Top ... |
 |
Pure ephedrine powder - Bulk ephedrine powder - Where to buy ephedrine powder | Продавец: 871344 | Message Whatsapp : +40 767 772 668contact Signal : Townrunner.01 Pure ephedrine powder Bulk... |
 |
BUY BENZODIAZEPINES AND RESEARCH CHEMICALS ONLINE | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 NB: All transactions between both parties remai... |
 |
5.4,4'-Oxydiphenol CAS 1965-09-9 | Продавец: Yufeng International Group Co., Ltd | Product Name: 4,4'-Oxydiphenol Synonyms: 4,4'-Dihydroxydiphenyl ether 4,4'-Oxydiphenol Bis(4-... |
