APETX2
ASIC3 channels, APETx2inhibits ASIC3 channels1
SPECIFICATION OF APETX2
|
CAT |
O1040-V |
|
CAS NO. |
|
|
Product Name |
APETx2 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4561 Da |
|
Molecular formula |
C196H280N54O61S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38) |
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As the professional custom peptide companyin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more details of Peptide CDMO, please leave us a message.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... |
Похожие товары
 |
Powder coatings for automotive interior parts MT-A2201/MT-YN203GF | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2201 powders can be used ... |
 |
Powder coatings for Automotive trim parts MT-A2201/MT-YN218GF / | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2201 powders can be used ... |
 |
Powder coatings for Automotive trim parts MT-A2201 /MT-YZ108GF | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT- A2201 clearcoats can be u... |
 |
Powder coatings for Automotive trim parts MT-A2201/MT-YZ204I | Продавец: Standard International Group (HK) Limited | Product Description MT- A2201 clearcoats can be used for pillars and appliqués, roof rack... |
 |
Basecoat powder coating MT-A2204/MT-MW188I | Продавец: Standard International Group (HK) Limited | WA：+86 132 6275 2056 WEB: std-coatings.com Product Description MT-A2204 basecoat comes in an... |
