.

CALCISEPTINE

Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.

SPECIFICATION OF CALCISEPTINE

Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)

Purity: > 98%(HPLC)

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 7167.40

Molecular formula: C304H477N91O88S11

Source: Chemical synthesis

Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCISEPTINE

Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.

KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry(Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.



Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

PALMITOYL PENTAPEPTIDE 4
PALMITOYL PENTAPEPTIDE 4 Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
PALMITOYL TETRAPEPTIDE 7
PALMITOYL TETRAPEPTIDE 7 Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
PROFESSIONAL PEPTIDE SUPPLIER
PROFESSIONAL PEPTIDE SUPPLIER , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ...
H3K4me3
H3K4me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
 AGATOXIN IVA
AGATOXIN IVA P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna...
Все товары поставщика

Похожие товары

Castrol Molub-Allloy Paste TA 1KG High temperature Lubricants
Castrol Molub-Allloy Paste TA 1KG High temperature Lubricants Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. Clean application, Easy assembly and disassembly, Prevents fretting corrosion, Good separating ...
Phenol Alkylation Plant
Phenol Alkylation Plant Продавец: Hubei Sanli Fengxiang Technology Co., Ltd Phenol Alkylation Plant Product Description Alkyl phenolis produced by the alkylation of phenol...
KYODO YUSHI PAREMAX SUPER 400G High Temperature Grease
KYODO YUSHI PAREMAX SUPER 400G High Temperature Grease Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. Excellent in heat-resistance, water-resistance and EP property as well as mechanical stability, a...
Mobil CHASSIS GREASE LBZ 16KG Exhibits Excellent Flow even at very low tempe Eatures and in Long Pipelines
Mobil CHASSIS GREASE LBZ 16KG Exhibits Excellent Flow even at very low tempe Eatures and in Long Pipelines Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. Mobil Chassis Grease LBZ je polotekuté plastické mazivo na bázi hydroxystear...
Mobil Velocite Oil No 6 Spindle Oil 16KG
Mobil Velocite Oil No 6 Spindle Oil 16KG Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. KLUBER MOLYKOTE EM-50L 1KG KLUBER MICROLUBE GBU-Y 131 1KG KLUBER CENTOPLEX GLP 500 1KG Kluber...