CALCISEPTINE

• 

Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.

SPECIFICATION OF CALCISEPTINE

Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)

Purity: > 98%(HPLC)

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 7167.40

Molecular formula: C304H477N91O88S11

Source: Chemical synthesis

Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCISEPTINE

Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.

KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.

Другие товары поставщика

	ACETYL OCTAPEPTIDE 3/1(SNAP-8)	Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar...
	H3K4ME1	Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ...
	PALMITOYL TETRAPEPTIDE 7	Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
	H3K4me3	As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
	ACETYL TETRAPEPTIDE 5(EYESERYL)	Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA...

Похожие товары

	Easy-cleaning Silicone-Modified Waterborne UV Resin	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d...
	Water-based Soft-Touch Resin for Consumer Electronics	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve...
	Conformal Coatings	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro...
	Metalized & Laser Transfer coating	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ...
	Hydrophilic coatings for Air Conditioner	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi...