CALCISEPTINE

• 

Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.

SPECIFICATION OF CALCISEPTINE

Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)

Purity: > 98%(HPLC)

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 7167.40

Molecular formula: C304H477N91O88S11

Source: Chemical synthesis

Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCISEPTINE

Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.

KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.

Другие товары поставщика

	H3K4me3	As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
	AGATOXIN IVA	P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna...
	SYN AKE	Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve...
	CALCICLUDINE	L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam...
	PALMITOYL TETRAPEPTIDE 7	Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...

Похожие товары

	Mobil DTE 832 ISO VG 32 208L Combined Cycle Turbine Oils	Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd.	Mobil DTE832and 846 aresuperior performance turbine oilsdesigned for use in steam turbines, gas t...
	MOBILUX EP 0 16KG Lithium Complex Grease	Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd.	This extreme pressure Grease has an NLGI Grade0comes in a 5-gallon bucket and weighs 38.53lbs. It...
	Nisin	Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd.	Nisin, a natural antimicrobial peptide, has various applications in the food industry due to its ...
	Nisin	Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd.	Nisin is considered a natural preservative because it is derived from the fermentation of bacteri...
	Nisin	Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd.	Nisin is a natural antimicrobial peptide produced by certain strains of the bacterium Lactococcus...