CALCISEPTINE

• 

Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.

SPECIFICATION OF CALCISEPTINE

Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)

Purity: > 98%(HPLC)

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 7167.40

Molecular formula: C304H477N91O88S11

Source: Chemical synthesis

Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCISEPTINE

Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.

KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.

Другие товары поставщика

	PALMITOYL TETRAPEPTIDE 7	Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
	ACETYL HEXAPEPTIDE 3(ARGIRELINE)	The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th...
	H3K4ME1	Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ...
	SHK TOXIN	Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig...
	ACETYL OCTAPEPTIDE 3/1(SNAP-8)	Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar...

Похожие товары

	Casting Grinding Balls	Продавец: 869376	Casting Grinding Balls , so called as Casting Grinding media balls,casting grinding steel ba...
	Key Quality Factors in Food Contact Paper Production	Продавец: Zhejiang Guanghe New Materials Co., Ltd.	Guanghe supplies food-grade parchment paper for commercial bakeries, food processors, restaurants...
	Heat Sealing Sterilization Pouch	Продавец: Hopeway AMD	Heat Sealing Sterilization Pouch is designed for secure medical instrument packaging, supporting ...
	Catalytic Converter Scrap Supplier, Catalytic Converter Scrap for Sale, , Catalytic Converter Scrap, Catalytic Scrap for Sale, Catalytic Scrap Supplier, Scrap Catalytic Supplier	Продавец: Trucont LLC	В компании Trucont LLC мы постоянно предлагаем лом каталитических преобразователей для немедленно...
	Epimedium Extract	Продавец: Fruit Powder,Vegetable Powder	Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ...