CALCISEPTINE
Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.
SPECIFICATION OF CALCISEPTINE
Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)
Purity: > 98%(HPLC)
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 7167.40
Molecular formula: C304H477N91O88S11
Source: Chemical synthesis
Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCISEPTINE
Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.
KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry(Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... | |
| MAMBALGIN 1 | ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ... | |
| H3K56AC | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with acetylation K56 modification. SPECIFICATION OF H3K5... | |
| PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... | |
| ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
Похожие товары
| Procaine | Продавец: 862043 | CAS:59-46-1 | |
| High Concentration Plastic Color Masterbatch Factory Direct Supply | Продавец: 861445 | We are a professional color masterbatch manufacturer with years of R&D experience in plastic ... | |
| Acid Ink Blue G Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Ink Blue G Factory 【Application of Acid Ink Blue G 】 mainly used for making blue or ... | |
| Acid Black ATT Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Black ATT Factory 【What’s Acid Black ATT】 is made of acid black 10B and acid o... | |
| Acid Black 10B Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Black 10B Factory is mainly suitable for dyeing and printing wool ,silk and nylon fabri... |













