CALCISEPTINE
Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.
SPECIFICATION OF CALCISEPTINE
Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)
Purity: > 98%(HPLC)
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 7167.40
Molecular formula: C304H477N91O88S11
Source: Chemical synthesis
Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCISEPTINE
Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.
KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry(Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
UB AMC | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U... | |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... | |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... | |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... | |
H3K4me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Похожие товары
INSTANT RAMEN AND CHONGQING NOODLES | Продавец: Anhui Three Brothers Potato Industry Co., Ltd | INSTANT RAMEN AND CHONGQING NOODLES The traditional Chinese delicacies, Chongqing noodles, and L... | |
INSTANT RAMENS SERIES | Продавец: Anhui Three Brothers Potato Industry Co., Ltd | INSTANT RAMENS SERIES There are four products in the instant ramen chinesebulk series. Lou zh... | |
INSTANT CHONGQING RICE NOODLES SERIES | Продавец: Anhui Three Brothers Potato Industry Co., Ltd | INSTANT CHONGQING RICE NOODLES SERIES Chongqing instant noodles is one of the well-known specialt... | |
N BULK WIDE SWEET POTATO GLASS NOODLES | Продавец: Anhui Three Brothers Potato Industry Co., Ltd | IN BULK WIDE SWEET POTATO GLASS NOODLES The Chinese clear sweet potato noodleswide is made of pu... | |
HOT POT WIDE GLASS NOODLES/VERMICELLI | Продавец: Anhui Three Brothers Potato Industry Co., Ltd | HOT POT WIDE GLASS NOODLES/VERMICELLI For hot pot ingredients, this hot pot Chinese wide vermice... |