CALCISEPTINE

• 

Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.

SPECIFICATION OF CALCISEPTINE

Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)

CAS N0.:

Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)

Purity: > 98%(HPLC)

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 7167.40

Molecular formula: C304H477N91O88S11

Source: Chemical synthesis

Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF CALCISEPTINE

Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.

KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.

Другие товары поставщика

	SPECIFICATION OF IBERIOTOXIN	CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph...
	KALIOTOXIN	The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ...
	MARGATOXIN	SPECIFICATION OF MARGATOXIN CAT K1020-V CAS NO. Product Name Margatoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water...
	APETX2	ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ...
	H3K4ME2	Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H...

Похожие товары

	Sucralose powder Food additive	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose, as a new generation of high-sweetness sweetener, has demonstrated comprehensive and ou...
	Sucralose Purchase price	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose, as a high-sweetness, calorie-free, and highly stable artificial sweetener, enjoys wide...
	Sucralose Partners, long-termCooperation	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is currently a widely used high-potency sweetener globally. Its safety has been verifie...
	Sucralose	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is a high-sweetness agent obtained by replacing the hydroxyl groups at positions 4, 1',...
	Sucralose	Продавец: Shanghai Yifu Food Ingredients Co., Ltd	Sucralose is a trichloro derivative of sucrose (4,1',6'-trichloro-4,1',6'-dideoxy-galactosucrose)...