PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
Same products
 |
Microcrystalline wax used for rubber plastic processing and modification | Seller: Syntop chemical Co.,Ltd. | Microcrystalline wax has a wide range of industrial applications, primarily in the areas of rubbe... |
 |
Microcrystalline wax 80A used for lubrication and demolding | Seller: Syntop chemical Co.,Ltd. | The core industrial applications of microcrystalline wax 80A are primarily focused on rubber prot... |
 |
Tyvek Flat Roll Pouch | Seller: Hopeway AMD | Tyvek Flat Roll Pouch is designed for professional sterilization packaging, offering clean handli... |
 |
Industrial Warehouse Ceiling Fans | Seller: Hebei Windmax Power Technology Co., Ltd. | Industrial Warehouse Ceiling Fans Industrial Warehouse Ceiling Fans for Warehouses, Logis... |
 |
HVLS Ceiling Fan for Railway Station | Seller: Hebei Windmax Power Technology Co., Ltd. | HVLS Ceiling Fan for Railway Station for Railway Station All units are CE-certified, manufa... |
