PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
Same products
 |
C500-1.7 Series High Flow Multi-Stage Centrifugal Blower /Centrifugal Blower | Seller: Greentech International (Zhangqiu) Co., Ltd | Greentech International (Zhangqiu) Co., Ltdis the professional blower supplier.Multistage Centrif... |
 |
Common Rail injector control valve F00VC01303 | Seller: China Lutong Part Plant | Common Rail injector control valve F00VC01303 Tina #Stainless Steel Cylindrical Pin# #Denso Comm... |
 |
Common Rail injector control valve F00VC01200 | Seller: China Lutong Part Plant | Common Rail injector control valve F00VC01200 Tina #Stainless Steel Cylindrical Pin# #Denso Comm... |
 |
Injector Control Valve Plate 24# | Seller: China Lutong Part Plant | Injector Control Valve Plate 24# Tina #Stainless Steel Cylindrical Pin# #Denso Common Rail Injec... |
 |
Injector Control Valve Plate 12# | Seller: China Lutong Part Plant | Injector Control Valve Plate 12# Tina #Stainless Steel Cylindrical Pin# #Denso Common Rail Injec... |
