PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
H3K4me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
MAMBALGIN 1 | ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
Same products
 |
10000L Bright Beer Tank | Seller: Shandong HG Engineering Equipment Co., Ltd. | 10000L Bright Beer Tank is often also called serving tank, tax determination tanks or clear beer ... |
 |
2000L Fermentation Tank | Seller: Shandong HG Engineering Equipment Co., Ltd. | 2000L Fermentation Tank is a Modular cylindrically-conical tank consist of a base tank (BT) and e... |
 |
300CPH(5CPM) Semi-Auto Beer Canning Machine | Seller: Shandong HG Engineering Equipment Co., Ltd. | 300CPH(5CPM) Semi-Auto Beer Canning Machine is specifically designed to beer filling and include ... |
 |
2000L 2 Vessel Copper Beer Brewing Equipment | Seller: Shandong HG Engineering Equipment Co., Ltd. | 2000L 2 Vessel Copper Beer Brewing Equipment , Copper has the highest heat conductivity, is easy ... |
 |
1000L 3 Vessel Beer Brewing Equipment | Seller: Shandong HG Engineering Equipment Co., Ltd. | 1000L 3 Vessel Beer Brewing Equipment is a brewery for restaurants, commecial and industrial brew... |
