PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
Same products
 |
Toy flammability tester | Seller: Qinsun Instruments Co., Ltd | The Toy burning tester is designed to determine the safety property (flammability) of equipment, ... |
 |
PCB circuit board manufacturer for computer component PCB assembly service | Seller: Shenzhen STHL Electronics Co.,Ltd. | SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished... |
 |
Full Automatic PCB Assembly for Industrial Automation Custom PCB Manufacture PCBA Service | Seller: Shenzhen STHL Electronics Co.,Ltd. | SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished... |
 |
PCBA Assembly Factory Android Motherboard Products PCBA Printed Circuit Board PCB SMT Service | Seller: Shenzhen STHL Electronics Co.,Ltd. | SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished... |
 |
PCBA customize air conditioner inverter universal single side PCB control board PCB assembly | Seller: Shenzhen STHL Electronics Co.,Ltd. | SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished... |
