PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
 |
H3K4me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
Same products
 |
Microcrystalline wax used for improving the flexibility of packaging materials | Seller: Syntop chemical Co.,Ltd. | Microcrystalline wax is a specialty wax extracted from petroleum. Its primary functions include t... |
 |
288 Holes Plastic Plant Trays | Seller: Hebei Marshine New Material Technology Co., Ltd. | 288 Holes Plastic Plant Trays 288 Holes Plastic Plant Trays of 288 holes are great for vege... |
 |
plastic bag | Seller: Hebei Marshine New Material Technology Co., Ltd. | plastic bag If you are a plant lover, you may have heard someone suggest putting a over a pl... |
 |
Seedling Tray Price Philippines - Marshine | Seller: Hebei Marshine New Material Technology Co., Ltd. | Seedling Tray Price Philippines - Marshine Seedling Tray Price Philippines - Marshine Find ... |
 |
Seedling Trays | Seller: Hebei Marshine New Material Technology Co., Ltd. | Seedling Trays Wholesale South Africa - Marshine Our seedling trays are exported to South A... |
