PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... |
 |
H3K9ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K9 modification. SPECIFICATION OF H... |
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
Same products
 |
Micronized polypropylene wax for injection moulding | Seller: Syntop chemical Co.,Ltd. | The incorporation of polypropylene micronized wax into injection moulding processes delivers the ... |
 |
Drum Type Mobile Mixing Station | Seller: Yousheng Machinery Equipment Co.,Ltd | Drum Type Mobile Mixing Station Drum Type Mobile Mixing StationPortable Drum Concrete Batch Plan... |
 |
Washable Cheap 13.56Mhz 213 Nfc Mini Stickers 13.56 Mhz RFID Label Sticker Tag HF/UHF Tags Dry Inlay | Seller: XIUCHENG RFID | Size：On request Material:PET, PVC,paper or customized Frequency:UHF/HF Printing:Thermal transf... |
 |
Micronized wax used for industrial paint processing | Seller: Syntop chemical Co.,Ltd. | Micronized wax is a vital functional additive in industrial paint processing, with primary functi... |
 |
Plant Growth Regulator Manufacturer | Seller: HEBEI LAIKE BIOTECH CO.LTD | Plant Growth Regulator Manufacturer Plant Growth Regulator Manufacturer - Laike Biotech spec... |
