.

PROTOXIN II

NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.

SPECIFICATION OF PROTOXIN II

CAT

N1030-V

CAS NO.

Product Name

Protoxin II

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

Molecular formula

C169H274N54O48S7

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32)

APPLICATION OF PROTOXIN II

Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.

As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

ACETYL HEXAPEPTIDE 3(ARGIRELINE)
ACETYL HEXAPEPTIDE 3(ARGIRELINE) The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th...
KALIOTOXIN
KALIOTOXIN The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ...
 AGATOXIN IVA
AGATOXIN IVA P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna...
H3K36me3
H3K36me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
PROFESSIONAL PEPTIDE SUPPLIER
PROFESSIONAL PEPTIDE SUPPLIER , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ...
All supplier products

Same products

Jewelry Display Stand
Jewelry Display Stand Seller: XIANJU YIJIA ART & CRAFTS CO.,LTD. Overview Usage: Jewelry Bracelet Ring Necklace Display Stand Material: MDF&resin&am...
Stainless Steel Panel Handleheld Garment Steamer
Stainless Steel Panel Handleheld Garment Steamer Seller: Ningbo Mayway Electrical appliance co.,Ltd. Power: 220-240V 50/60Hz 1500W Water tank capacity: 280ML Basic Function : Big stainless steel pan...
Weather-resistant Adhesive For Neutral Curtainwall
Weather-resistant Adhesive For Neutral Curtainwall Seller: Zhongtian East Fluorine Silicon Material Co., Ltd Name: Weather-resistant Adhesive For Neutral Curtainwall Feature: GS885 is one component, neut...
Trimethylchlorosilane (M3)
Trimethylchlorosilane (M3) Seller: Zhongtian East Fluorine Silicon Material Co., Ltd Name: Trimethylchlorosilane Feature: Trimethy lchloro silane is a colorless or light yellow tra...
Silicone Window & Door Sealant
Silicone Window & Door Sealant Seller: Zhongtian East Fluorine Silicon Material Co., Ltd Name: Silicone Window Sealant& Door Sealant Features: One component, neutral, room tem...