PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
CAT |
N1030-V |
CAS NO. |
|
Product Name |
Protoxin II |
Purity |
> 98% |
Form/State |
Lyophilized powder |
Solubility |
Soluble in water |
Molecular weight |
|
Molecular formula |
C169H274N54O48S7 |
Source |
Synthetic peptide |
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th... | |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... | |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... | |
H3K36me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... | |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
Same products
Jewelry Display Stand | Seller: XIANJU YIJIA ART & CRAFTS CO.,LTD. | Overview Usage: Jewelry Bracelet Ring Necklace Display Stand Material: MDF&resin&am... | |
Stainless Steel Panel Handleheld Garment Steamer | Seller: Ningbo Mayway Electrical appliance co.,Ltd. | Power: 220-240V 50/60Hz 1500W Water tank capacity: 280ML Basic Function : Big stainless steel pan... | |
Weather-resistant Adhesive For Neutral Curtainwall | Seller: Zhongtian East Fluorine Silicon Material Co., Ltd | Name: Weather-resistant Adhesive For Neutral Curtainwall Feature: GS885 is one component, neut... | |
Trimethylchlorosilane (M3) | Seller: Zhongtian East Fluorine Silicon Material Co., Ltd | Name: Trimethylchlorosilane Feature: Trimethy lchloro silane is a colorless or light yellow tra... | |
Silicone Window & Door Sealant | Seller: Zhongtian East Fluorine Silicon Material Co., Ltd | Name: Silicone Window Sealant& Door Sealant Features: One component, neutral, room tem... |