PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
CAT |
N1030-V |
CAS NO. |
|
Product Name |
Protoxin II |
Purity |
> 98% |
Form/State |
Lyophilized powder |
Solubility |
Soluble in water |
Molecular weight |
|
Molecular formula |
C169H274N54O48S7 |
Source |
Synthetic peptide |
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... | |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... | |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... | |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... | |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
Same products
Mechanic iTough X Tough Superfine Cutting Wire For LCD OLED Screen | Seller: Shenzhen PHONEFIX technology Co.,Ltd | Mechanic iTough X tough cutting wire suitable for LCD/OLED screen separation, Mechanic high hardn... | |
Barbed Skullcap Herb | Seller: Hangzhou Botanical Technology Co., Ltd. | The quality and effect of plants could be various due to different environments which they live i... | |
Mint Leaf | Seller: Hangzhou Botanical Technology Co., Ltd. | Mint leaves, scientifically known as Mentha, belong to a diverse genus of aromatic herbs from the... | |
Arborvitae Leaf and Twig | Seller: Hangzhou Botanical Technology Co., Ltd. | Arborvitae, scientifically known as Thuja occidentalis, is a type of evergreen tree native to Nor... | |
Plantain Herb | Seller: Hangzhou Botanical Technology Co., Ltd. | Plantain herb, scientifically known as Plantago major, is a versatile and widely distributed medi... |