PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
PROFESSIONAL PEPTIDE SUPPLIER | PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
 |
H3K4ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K4 modification. SPECIFICATION OF ... |
 |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... |
Same products
 |
Microcrystalline wax as rust inhibitor | Seller: Syntop chemical Co.,Ltd. | Microcrystalline wax is indeed one of the key ingredients in rust inhibitors. Thanks to its excel... |
 |
Microcrystalline wax used in lubrication and sealing | Seller: Syntop chemical Co.,Ltd. | Thanks to its high gel strength, strong adhesion, good flexibility, and excellent temperature res... |
 |
Nembutal | Pentobarbital | Dignitas | Pegasos in Europe | Seller: How to buy Nembutal Pentobarbital safely online in Europe | Dignitas and Pegasos for sale in Europe Dignitas and Pegasos Nembutal f... |
 |
Price for Nembutal in Spain | Pentobarbital price in Italy | Seller: How to buy Nembutal Pentobarbital safely online in Europe | Dignitas and Pegasos for sale in Europe Dignitas and Pegasos Nembutal f... |
 |
Buy Pentobarbital in France | Buy Nembutal in Spain and Europe | Seller: How to buy Nembutal Pentobarbital safely online in Europe | Dignitas and Pegasos for sale in Europe Dignitas and Pegasos Nembutal f... |
