PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
 |
UB AMC | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
H3K36me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... |
Same products
 |
YC160W Wheel excavator YC160W | Seller: Guangxi Yuchai Equipment Technology Co., Ltd | YC160W Wheel excavator YC160W wheel excavator is a new generation of full hydraulic wheel excavat... |
 |
Yuchai U20 mini excavator | Seller: Guangxi Yuchai Equipment Technology Co., Ltd | Yuchai U20 mini excavator Improvements in Over 80 Details: Tailless Excavator U20 is a Yuchai ... |
 |
Yuchai YC80 small excavator | Seller: Guangxi Yuchai Equipment Technology Co., Ltd | Yuchai YC80 small excavator International brand engine It is equipped with Yanmar 4TNV98C natur... |
 |
Top Type Hydraulic Breaker | Seller: Guangxi Yuchai Equipment Technology Co., Ltd | Top Type Hydraulic Breaker With the higher restriction of blasting control,hydraulic breakeris w... |
 |
S35-Electric Skid Steer Loader | Seller: Guangxi Yuchai Equipment Technology Co., Ltd | S35-Electric Skid Steer Loader Yuchai S35 Electric Skid Steer Loaderis compact and flexible, des... |
