PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
| PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... | |
| PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... | |
| PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... | |
| SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... | |
| APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
Same products
| Cable Wire Recycling Production Line | Seller: Changzhou Optima Technology Co.,Ltd. | Cable Wire Recycling Production Line 1000kg Copper Wire Recycling Machines: The biggest ca... | |
| Small Cable Granulator and Separator | Seller: Changzhou Optima Technology Co.,Ltd. | Small Cable Granulator and Separator : Small shape,1 phase power,grind and separate copper f... | |
| Turnkey service of tire recycling | Seller: Changzhou Optima Technology Co.,Ltd. | Turnkey service of tire recycling At , we specialize in manufacturing advanced tire recyclin... | |
| Mobile Portable Tire Shredder | Seller: Changzhou Optima Technology Co.,Ltd. | Mobile Portable Tire Shredder Mobile Portable Tire Shredder – A cost-effective soluti... | |
| Aluminum wire rod rewinding machine | Seller: Changzhou Optima Technology Co.,Ltd. | Aluminum wire rod rewinding machine Basic Introduction 's is engineered with advanced Korea... |
















