PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
Protoxin II |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As thebest polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K9ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K9 modification. SPECIFICATION OF H... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
Same products
 |
FT wax used for EVA-based hot melt adhesive | Seller: Syntop chemical Co.,Ltd. | Fischer-Tropsch wax is a commonly used performance modifier in hot melt adhesives, especially for... |
 |
high melting point FT wax improve the heat resistance of adhesives | Seller: Syntop chemical Co.,Ltd. | FischerTropsch wax is an alkane polymer produced from synthesis gas or natural gas via the Fische... |
 |
For hot melt adhesive high melting point FT WAX | Seller: Syntop chemical Co.,Ltd. | The key advantage of high-melting-point Fischer-Tropsch wax in hot-melt adhesives stems from its ... |
 |
Diesel Injection Delivery Valve 1W6982 Diesel Injection Delivery Valve 19A | Seller: China lutong | Diesel Injection Delivery Valve 1W6982 Diesel Injection Delivery Valve 19AChris Diesel Injection... |
 |
High melting point FT wax used as plastic processing additives | Seller: Syntop chemical Co.,Ltd. | Due to its high purity, low oil content, narrow melting range, high hardness, and excellent therm... |
