PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so... |
 |
KURTOXIN | SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Acetyl octapeptide 31(SNAP-8) Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild... |
Похожие товары
 |
10000L Bright Beer Tank | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 10000L Bright Beer Tank is often also called serving tank, tax determination tanks or clear beer ... |
 |
2000L Fermentation Tank | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 2000L Fermentation Tank is a Modular cylindrically-conical tank consist of a base tank (BT) and e... |
 |
300CPH(5CPM) Semi-Auto Beer Canning Machine | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 300CPH(5CPM) Semi-Auto Beer Canning Machine is specifically designed to beer filling and include ... |
 |
2000L 2 Vessel Copper Beer Brewing Equipment | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 2000L 2 Vessel Copper Beer Brewing Equipment , Copper has the highest heat conductivity, is easy ... |
 |
1000L 3 Vessel Beer Brewing Equipment | Продавец: Shandong HG Engineering Equipment Co., Ltd. | 1000L 3 Vessel Beer Brewing Equipment is a brewery for restaurants, commecial and industrial brew... |
