PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
Похожие товары
 |
Micronized polypropylene wax for injection moulding | Продавец: Syntop chemical Co.,Ltd. | The incorporation of polypropylene micronized wax into injection moulding processes delivers the ... |
 |
Drum Type Mobile Mixing Station | Продавец: Yousheng Machinery Equipment Co.,Ltd | Drum Type Mobile Mixing Station Drum Type Mobile Mixing StationPortable Drum Concrete Batch Plan... |
 |
Washable Cheap 13.56Mhz 213 Nfc Mini Stickers 13.56 Mhz RFID Label Sticker Tag HF/UHF Tags Dry Inlay | Продавец: XIUCHENG RFID | Size：On request Material:PET, PVC,paper or customized Frequency:UHF/HF Printing:Thermal transf... |
 |
Micronized wax used for industrial paint processing | Продавец: Syntop chemical Co.,Ltd. | Micronized wax is a vital functional additive in industrial paint processing, with primary functi... |
 |
Plant Growth Regulator Manufacturer | Продавец: HEBEI LAIKE BIOTECH CO.LTD | Plant Growth Regulator Manufacturer Plant Growth Regulator Manufacturer - Laike Biotech spec... |
