PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
UB AMC | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U... |
 |
MAMBALGIN 1 | ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ... |
 |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
Похожие товары
 |
Micronized PP PE wax used for Injection Molding | Продавец: Syntop chemical Co.,Ltd. | The primary use of polypropylene micropowder wax is as a surface-modifying additive, mainly appli... |
 |
Marlboro red for sale / Wholesale Marlboro cigarettes | Продавец: 871344 | Whatsapp : +40 767 772 668Signal : Townrunner.01 Marlboro red for sale Wholesale Marlboro ciga... |
 |
MEGA M-PR 3.1 ბლოკის და ბეტონის ქვაფენილის საწარმოო დანადგარის კომპლექტი | Продавец: VBM GLOBAL | |
 |
Micronized wax used for significantly improving wear resistance | Продавец: Syntop chemical Co.,Ltd. | Micro-powdered wax is a micron-sized wax powder additive primarily used to improve surface proper... |
 |
450ml Nanzhu Bamboo Coffee Handle Mug | Продавец: 865087 | The 450ml Nanzhu Bamboo Coffee Handle Mug from Yongkang Aijun Industry & Trade Co., Ltd. comb... |
