PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
Похожие товары
 |
FT wax used for EVA-based hot melt adhesive | Продавец: Syntop chemical Co.,Ltd. | Fischer-Tropsch wax is a commonly used performance modifier in hot melt adhesives, especially for... |
 |
high melting point FT wax improve the heat resistance of adhesives | Продавец: Syntop chemical Co.,Ltd. | FischerTropsch wax is an alkane polymer produced from synthesis gas or natural gas via the Fische... |
 |
For hot melt adhesive high melting point FT WAX | Продавец: Syntop chemical Co.,Ltd. | The key advantage of high-melting-point Fischer-Tropsch wax in hot-melt adhesives stems from its ... |
 |
Diesel Injection Delivery Valve 1W6982 | Продавец: China lutong | Diesel Injection Delivery Valve 1W6982 Diesel Injection Delivery Valve 19AChris Diesel Injection... |
 |
High melting point FT wax used as plastic processing additives | Продавец: Syntop chemical Co.,Ltd. | Due to its high purity, low oil content, narrow melting range, high hardness, and excellent therm... |
