PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... | |
| PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... | |
| L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... | |
| MAMBALGIN 1 | ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ... | |
| SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... |
Похожие товары
| C500-1.7 Series High Flow Multi-Stage Centrifugal Blower /Centrifugal Blower | Продавец: Greentech International (Zhangqiu) Co., Ltd | Greentech International (Zhangqiu) Co., Ltdis the professional blower supplier.Multistage Centrif... | |
| Common Rail injector control valve F00VC01303 | Продавец: China Lutong Part Plant | Common Rail injector control valve F00VC01303 Tina#Stainless Steel Cylindrical Pin##Denso Common... | |
| Common Rail injector control valve F00VC01200 | Продавец: China Lutong Part Plant | Common Rail injector control valve F00VC01200 Tina#Stainless Steel Cylindrical Pin##Denso Common... | |
| Injector Control Valve Plate 24# | Продавец: China Lutong Part Plant | Injector Control Valve Plate 24# Tina#Stainless Steel Cylindrical Pin##Denso Common Rail Injecto... | |
| Injector Control Valve Plate 12# | Продавец: China Lutong Part Plant | Injector Control Valve Plate 12# Tina#Stainless Steel Cylindrical Pin##Denso Common Rail Injecto... |















