PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... | |
| CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... | |
| H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... | |
| PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... | |
| AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
Похожие товары
| YC160W Wheel excavator YC160W | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | YC160W Wheel excavator YC160W wheel excavator is a new generation of full hydraulic wheel excavat... | |
| Yuchai U20 mini excavator | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Yuchai U20 mini excavator Improvements in Over 80 Details: Tailless Excavator U20 is a Yuchai ... | |
| Yuchai YC80 small excavator | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Yuchai YC80 small excavator International brand engine It is equipped with Yanmar 4TNV98C natur... | |
| Top Type Hydraulic Breaker | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | Top Type Hydraulic Breaker With the higher restriction of blasting control,hydraulic breakeris w... | |
| S35-Electric Skid Steer Loader | Продавец: Guangxi Yuchai Equipment Technology Co., Ltd | S35-Electric Skid Steer Loader Yuchai S35 Electric Skid Steer Loaderis compact and flexible, des... |
















