PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Похожие товары
 |
Common Rail injector control valve F00V C01 365 & Common Rail injector control valve F00V C01 368 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 365 Common Rail injector control valve F00V C01 368 C... |
 |
Common Rail injector control valve F00V C01 362 & Common Rail injector control valve F00V C01 363 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 362 Common Rail injector control valve F00V C01 363 C... |
 |
Common Rail injector control valve F00V C01 358 & Common Rail injector control valve F00V C01 359 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 358 Common Rail injector control valve F00V C01 359 C... |
 |
Common Rail injector control valve F00V C01 355 & Common Rail injector control valve F00V C01 356 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 355 Common Rail injector control valve F00V C01 356 C... |
 |
Common Rail injector control valve F00V C01 352 & Common Rail injector control valve F00V C01 353 | Продавец: zhonglutong | Common Rail injector control valve F00V C01 352 Common Rail injector control valve F00V C01 353 C... |
