PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... |
 |
KURTOXIN | SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
Похожие товары
 |
Microcrystalline wax as rust inhibitor | Продавец: Syntop chemical Co.,Ltd. | Microcrystalline wax is indeed one of the key ingredients in rust inhibitors. Thanks to its excel... |
 |
Microcrystalline wax used in lubrication and sealing | Продавец: Syntop chemical Co.,Ltd. | Thanks to its high gel strength, strong adhesion, good flexibility, and excellent temperature res... |
 |
нембутал | Пентобарбитал | Дигнитас | Пегасы в Европе | Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе | Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю... |
 |
Цена на Нембутал в Испании | Цена на пентобарбитал в Италии | Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе | Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю... |
 |
Купить пентобарбитал во Франции | Купить нембутал в Испании и Европе | Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе | Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю... |
