PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K36me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
|
|
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
Похожие товары
 |
Microcrystalline wax used for improving the flexibility of packaging materials | Продавец: Syntop chemical Co.,Ltd. | Microcrystalline wax is a specialty wax extracted from petroleum. Its primary functions include t... |
 |
288 Holes Plastic Plant Trays | Продавец: Hebei Marshine New Material Technology Co., Ltd. | 288 Holes Plastic Plant Trays 288 Holes Plastic Plant Trays of 288 holes are great for vege... |
 |
plastic bag | Продавец: Hebei Marshine New Material Technology Co., Ltd. | plastic bag If you are a plant lover, you may have heard someone suggest putting a over a pl... |
 |
Seedling Tray Price Philippines - Marshine | Продавец: Hebei Marshine New Material Technology Co., Ltd. | Seedling Tray Price Philippines - Marshine Seedling Tray Price Philippines - Marshine Find ... |
 |
Seedling Trays | Продавец: Hebei Marshine New Material Technology Co., Ltd. | Seedling Trays Wholesale South Africa - Marshine Our seedling trays are exported to South A... |
