PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
H3K4ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K4 modification. SPECIFICATION OF ... |
Same products
 |
Microcrystalline wax as rust inhibitor | Seller: Syntop chemical Co.,Ltd. | Microcrystalline wax is indeed one of the key ingredients in rust inhibitors. Thanks to its excel... |
 |
Microcrystalline wax used in lubrication and sealing | Seller: Syntop chemical Co.,Ltd. | Thanks to its high gel strength, strong adhesion, good flexibility, and excellent temperature res... |
 |
Nembutal | Pentobarbital | Dignitas | Pegasos in Europe | Seller: How to buy Nembutal Pentobarbital safely online in Europe | Dignitas and Pegasos for sale in Europe Dignitas and Pegasos Nembutal f... |
 |
Price for Nembutal in Spain | Pentobarbital price in Italy | Seller: How to buy Nembutal Pentobarbital safely online in Europe | Dignitas and Pegasos for sale in Europe Dignitas and Pegasos Nembutal f... |
 |
Buy Pentobarbital in France | Buy Nembutal in Spain and Europe | Seller: How to buy Nembutal Pentobarbital safely online in Europe | Dignitas and Pegasos for sale in Europe Dignitas and Pegasos Nembutal f... |
