PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
H3K4ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K4 modification. SPECIFICATION OF ... |
 |
H3K36me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
MARGATOXIN | SPECIFICATION OF MARGATOXIN CAT K1020-V CAS NO. Product Name Margatoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
 |
Toy flammability tester | Seller: Qinsun Instruments Co., Ltd | The Toy burning tester is designed to determine the safety property (flammability) of equipment, ... |
 |
PCB circuit board manufacturer for computer component PCB assembly service | Seller: Shenzhen STHL Electronics Co.,Ltd. | SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished... |
 |
Full Automatic PCB Assembly for Industrial Automation Custom PCB Manufacture PCBA Service | Seller: Shenzhen STHL Electronics Co.,Ltd. | SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished... |
 |
PCBA Assembly Factory Android Motherboard Products PCBA Printed Circuit Board PCB SMT Service | Seller: Shenzhen STHL Electronics Co.,Ltd. | SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished... |
 |
PCBA customize air conditioner inverter universal single side PCB control board PCB assembly | Seller: Shenzhen STHL Electronics Co.,Ltd. | SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished... |
