.

PSALMOTOXIN 1

ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2

SPECIFICATION OF PSALMOTOXIN 1

CAT

O1120-V

CAS NO.

/

Product Name

Psalmotoxin 1

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

Molecular formula

C200H312N62O57S6

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33)

APPLICATION OF PSALMOTOXIN 1

Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).

As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

H3K4me3
H3K4me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
NONAPEPTIDE 1
NONAPEPTIDE 1 Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
 AGATOXIN IVA
AGATOXIN IVA P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna...
H3K9me1
H3K9me1 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
KALIOTOXIN
KALIOTOXIN The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ...
All supplier products

Same products

Chain Link Fence Machine LANDYOUNG
Chain Link Fence Machine LANDYOUNG Seller: LANDYOUNG GROUP Introduction: The automatic chain link fence machine is welded of high-quality steel and chann...
Black Annealed Wire LANDYOUNG
Black Annealed Wire LANDYOUNG Seller: LANDYOUNG GROUP Products Black Annealed Wire Material SAE1006; SAE1008; Q195; ...
electro galvanized wire LANDYOUNG
electro galvanized wire LANDYOUNG Seller: LANDYOUNG GROUP Products Electro-Galvanized Wire (GI wire) Diameter(mm) Zinc T...
Hot Dipped Galvanized Wire LANDYOUNG
Hot Dipped Galvanized Wire LANDYOUNG Seller: LANDYOUNG GROUP Products Hot Dipped Galvanized Wire (HDG wire) Diameter(mm) Zinc...
Velcro Heat Sleeve
Velcro Heat Sleeve Seller: Ningguo Xinmao Fiberglass Products Co., Ltd. QIAN-ZE velcro heat sleeveprovides the same protection against extreme heat conditions and occasi...