PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... |
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
 |
10000L Bright Beer Tank | Seller: Shandong HG Engineering Equipment Co., Ltd. | 10000L Bright Beer Tank is often also called serving tank, tax determination tanks or clear beer ... |
 |
2000L Fermentation Tank | Seller: Shandong HG Engineering Equipment Co., Ltd. | 2000L Fermentation Tank is a Modular cylindrically-conical tank consist of a base tank (BT) and e... |
 |
300CPH(5CPM) Semi-Auto Beer Canning Machine | Seller: Shandong HG Engineering Equipment Co., Ltd. | 300CPH(5CPM) Semi-Auto Beer Canning Machine is specifically designed to beer filling and include ... |
 |
2000L 2 Vessel Copper Beer Brewing Equipment | Seller: Shandong HG Engineering Equipment Co., Ltd. | 2000L 2 Vessel Copper Beer Brewing Equipment , Copper has the highest heat conductivity, is easy ... |
 |
1000L 3 Vessel Beer Brewing Equipment | Seller: Shandong HG Engineering Equipment Co., Ltd. | 1000L 3 Vessel Beer Brewing Equipment is a brewery for restaurants, commecial and industrial brew... |
