PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As thebest peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
Send product request
Other supplier products
 |
SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
 |
H3K36me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
 |
C500-1.7 Series High Flow Multi-Stage Centrifugal Blower /Centrifugal Blower | Seller: Greentech International (Zhangqiu) Co., Ltd | Greentech International (Zhangqiu) Co., Ltdis the professional blower supplier.Multistage Centrif... |
 |
Common Rail injector control valve F00VC01303 | Seller: China Lutong Part Plant | Common Rail injector control valve F00VC01303 Tina #Stainless Steel Cylindrical Pin# #Denso Comm... |
 |
Common Rail injector control valve F00VC01200 | Seller: China Lutong Part Plant | Common Rail injector control valve F00VC01200 Tina #Stainless Steel Cylindrical Pin# #Denso Comm... |
 |
Injector Control Valve Plate 24# | Seller: China Lutong Part Plant | Injector Control Valve Plate 24# Tina #Stainless Steel Cylindrical Pin# #Denso Common Rail Injec... |
 |
Injector Control Valve Plate 12# | Seller: China Lutong Part Plant | Injector Control Valve Plate 12# Tina #Stainless Steel Cylindrical Pin# #Denso Common Rail Injec... |
