PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide synthesis chinathat inhibits cation currents mediated by acid-sensing ion channels (ASIC).
More details of toxicological analysis, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
Похожие товары
 |
UB AMC | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumar... |
 |
SYN AKE | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimi... |
 |
SHK TOXIN | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar ... |
 |
SEMAGLUTIDE AND IMPURITY | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide ana... |
|
|
PSALMOTOXIN 1 | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (AS... |
