.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

H3K4ME1
H3K4ME1 Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ...
PALMITOYL PENTAPEPTIDE 4
PALMITOYL PENTAPEPTIDE 4 Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
H3K36me3
H3K36me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
UB AMC
UB AMC UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U...
NONAPEPTIDE 1
NONAPEPTIDE 1 Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
Все товары поставщика

Похожие товары

Micronized polypropylene wax for injection moulding
Micronized polypropylene wax for injection moulding Продавец: Syntop chemical Co.,Ltd. The incorporation of polypropylene micronized wax into injection moulding processes delivers the ...
Drum Type Mobile Mixing Station
Drum Type Mobile Mixing Station Продавец: Yousheng Machinery Equipment Co.,Ltd Drum Type Mobile Mixing Station Drum Type Mobile Mixing StationPortable Drum Concrete Batch Plan...
Washable Cheap 13.56Mhz 213 Nfc Mini Stickers 13.56 Mhz RFID Label Sticker Tag HF/UHF Tags Dry Inlay
Washable Cheap 13.56Mhz 213 Nfc Mini Stickers 13.56 Mhz RFID Label Sticker Tag HF/UHF Tags Dry Inlay Продавец: XIUCHENG RFID Size:On request Material:PET, PVC,paper or customized Frequency:UHF/HF Printing:Thermal transf...
Micronized wax used for industrial paint processing
Micronized wax used for industrial paint processing Продавец: Syntop chemical Co.,Ltd. Micronized wax is a vital functional additive in industrial paint processing, with primary functi...
Plant Growth Regulator Manufacturer
Plant Growth Regulator Manufacturer Продавец: HEBEI LAIKE BIOTECH CO.LTD Plant Growth Regulator Manufacturer Plant Growth Regulator Manufacturer - Laike Biotech spec...