.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.



Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

SPECIFICATION OF IBERIOTOXIN
SPECIFICATION OF IBERIOTOXIN CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph...
Ω AGATOXIN IVB
Ω AGATOXIN IVB P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI...
H3K9ME3
H3K9ME3 Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ...
H3S10PH
H3S10PH Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O...
NONAPEPTIDE 1
NONAPEPTIDE 1 Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
Все товары поставщика

Похожие товары

Common Rail injector control valve F00V C01 365 & Common Rail injector control valve F00V C01 368
Common Rail injector control valve F00V C01 365 & Common Rail injector control valve F00V C01 368 Продавец: zhonglutong Common Rail injector control valve F00V C01 365 Common Rail injector control valve F00V C01 368 C...
Common Rail injector control valve F00V C01 362 & Common Rail injector control valve F00V C01 363
Common Rail injector control valve F00V C01 362 & Common Rail injector control valve F00V C01 363 Продавец: zhonglutong Common Rail injector control valve F00V C01 362 Common Rail injector control valve F00V C01 363 C...
Common Rail injector control valve F00V C01 358 & Common Rail injector control valve F00V C01 359
Common Rail injector control valve F00V C01 358 & Common Rail injector control valve F00V C01 359 Продавец: zhonglutong Common Rail injector control valve F00V C01 358 Common Rail injector control valve F00V C01 359 C...
Common Rail injector control valve F00V C01 355 & Common Rail injector control valve F00V C01 356
Common Rail injector control valve F00V C01 355 & Common Rail injector control valve F00V C01 356 Продавец: zhonglutong Common Rail injector control valve F00V C01 355 Common Rail injector control valve F00V C01 356 C...
Common Rail injector control valve F00V C01 352 & Common Rail injector control valve F00V C01 353
Common Rail injector control valve F00V C01 352 & Common Rail injector control valve F00V C01 353 Продавец: zhonglutong Common Rail injector control valve F00V C01 352 Common Rail injector control valve F00V C01 353 C...