.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

SHK TOXIN
SHK TOXIN Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig...
OCTREOTIDE
OCTREOTIDE Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti...
H3K9ME3
H3K9ME3 Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ...
NONAPEPTIDE 1
NONAPEPTIDE 1 Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
PALMITOYL TETRAPEPTIDE 7
PALMITOYL TETRAPEPTIDE 7 Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
Все товары поставщика

Похожие товары

Microcrystalline wax as rust inhibitor
Microcrystalline wax as rust inhibitor Продавец: Syntop chemical Co.,Ltd. Microcrystalline wax is indeed one of the key ingredients in rust inhibitors. Thanks to its excel...
Microcrystalline wax used in lubrication and sealing
Microcrystalline wax used in lubrication and sealing Продавец: Syntop chemical Co.,Ltd. Thanks to its high gel strength, strong adhesion, good flexibility, and excellent temperature res...
нембутал | Пентобарбитал | Дигнитас | Пегасы в Европе
нембутал | Пентобарбитал | Дигнитас | Пегасы в Европе Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю...
Цена на Нембутал в Испании | Цена на пентобарбитал в Италии
Цена на Нембутал в Испании | Цена на пентобарбитал в Италии Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю...
Купить пентобарбитал во Франции | Купить нембутал в Испании и Европе
Купить пентобарбитал во Франции | Купить нембутал в Испании и Европе Продавец: Как безопасно купить Нембутал (пентобарбитал) онлайн в Европе Dignitas и Pegasos продаются в Европе Dignitas и Pegasos Nembutal продаю...