.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

MARGATOXIN
MARGATOXIN SPECIFICATION OF MARGATOXIN CAT K1020-V CAS NO. Product Name Margatoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water...
H3K56ac
H3K56ac As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
CALCISEPTINE
CALCISEPTINE Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ...
PROTOXIN II
PROTOXIN II NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2...
PALMITOYL TRIPEPTIDE 1(PAL GHK)
PALMITOYL TRIPEPTIDE 1(PAL GHK) Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY...
Все товары поставщика

Похожие товары

YC160W Wheel excavator YC160W
YC160W Wheel excavator YC160W Продавец: Guangxi Yuchai Equipment Technology Co., Ltd YC160W Wheel excavator YC160W wheel excavator is a new generation of full hydraulic wheel excavat...
 Yuchai U20 mini excavator
Yuchai U20 mini excavator Продавец: Guangxi Yuchai Equipment Technology Co., Ltd Yuchai U20 mini excavator Improvements in Over 80 Details: Tailless Excavator U20 is a Yuchai ...
Yuchai YC80 small excavator
Yuchai YC80 small excavator Продавец: Guangxi Yuchai Equipment Technology Co., Ltd Yuchai YC80 small excavator International brand engine It is equipped with Yanmar 4TNV98C natur...
Top Type Hydraulic Breaker
Top Type Hydraulic Breaker Продавец: Guangxi Yuchai Equipment Technology Co., Ltd Top Type Hydraulic Breaker With the higher restriction of blasting control,hydraulic breakeris w...
S35-Electric Skid Steer Loader
S35-Electric Skid Steer Loader Продавец: Guangxi Yuchai Equipment Technology Co., Ltd S35-Electric Skid Steer Loader Yuchai S35 Electric Skid Steer Loaderis compact and flexible, des...