.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

L CARNOSINE
L CARNOSINE LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i...
OCTREOTIDE
OCTREOTIDE Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti...
PROTOXIN II
PROTOXIN II NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2...
H3K4ME1
H3K4ME1 Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ...
NONAPEPTIDE 1
NONAPEPTIDE 1 Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
Все товары поставщика

Похожие товары

Cable Wire Recycling Production Line
Cable Wire Recycling Production Line Продавец: Changzhou Optima Technology Co.,Ltd. Cable Wire Recycling Production Line 1000kg Copper Wire Recycling Machines: The biggest ca...
Small Cable Granulator and Separator
Small Cable Granulator and Separator Продавец: Changzhou Optima Technology Co.,Ltd. Small Cable Granulator and Separator : Small shape,1 phase power,grind and separate copper f...
Turnkey service of  tire recycling
Turnkey service of tire recycling Продавец: Changzhou Optima Technology Co.,Ltd. Turnkey service of tire recycling At , we specialize in manufacturing advanced tire recyclin...
Mobile Portable Tire Shredder
Mobile Portable Tire Shredder Продавец: Changzhou Optima Technology Co.,Ltd. Mobile Portable Tire Shredder Mobile Portable Tire Shredder – A cost-effective soluti...
Aluminum wire rod rewinding machine
Aluminum wire rod rewinding machine Продавец: Changzhou Optima Technology Co.,Ltd. Aluminum wire rod rewinding machine Basic Introduction 's is engineered with advanced Korea...