.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

PALMITOYL TRIPEPTIDE 1(PAL GHK)
PALMITOYL TRIPEPTIDE 1(PAL GHK) Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY...
KURTOXIN
KURTOXIN SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ...
PSALMOTOXIN 1
PSALMOTOXIN 1 ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ...
H3K79ME2
H3K79ME2 Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ...
KALIOTOXIN
KALIOTOXIN The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ...
Все товары поставщика

Похожие товары

FT wax used for EVA-based hot melt adhesive
FT wax used for EVA-based hot melt adhesive Продавец: Syntop chemical Co.,Ltd. Fischer-Tropsch wax is a commonly used performance modifier in hot melt adhesives, especially for...
high melting point FT wax improve the heat resistance of adhesives
high melting point FT wax improve the heat resistance of adhesives Продавец: Syntop chemical Co.,Ltd. FischerTropsch wax is an alkane polymer produced from synthesis gas or natural gas via the Fische...
For hot melt adhesive high melting point FT WAX
For hot melt adhesive high melting point FT WAX Продавец: Syntop chemical Co.,Ltd. The key advantage of high-melting-point Fischer-Tropsch wax in hot-melt adhesives stems from its ...
Diesel Injection Delivery Valve 1W6982
Diesel Injection Delivery Valve 1W6982 Продавец: China lutong Diesel Injection Delivery Valve 1W6982 Diesel Injection Delivery Valve 19AChris Diesel Injection...
High melting point FT wax used as plastic processing additives
High melting point FT wax used as plastic processing additives Продавец: Syntop chemical Co.,Ltd. Due to its high purity, low oil content, narrow melting range, high hardness, and excellent therm...