MARGATOXIN
SPECIFICATION OF MARGATOXIN
CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)
APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.
As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.
在线联系供应商
Other supplier products
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
MAMBALGIN 1 | ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ... |
