.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

PALMITOYL PENTAPEPTIDE 4
PALMITOYL PENTAPEPTIDE 4 Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
H3K4me3
H3K4me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
PEPTIDE PRODUCTS
PEPTIDE PRODUCTS Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in...
PLECANATIDE
PLECANATIDE Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation...
APETX2
APETX2 ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ...
All supplier products

Same products

YC160W Wheel excavator YC160W
YC160W Wheel excavator YC160W Seller: Guangxi Yuchai Equipment Technology Co., Ltd YC160W Wheel excavator YC160W wheel excavator is a new generation of full hydraulic wheel excavat...
 Yuchai U20 mini excavator
Yuchai U20 mini excavator Seller: Guangxi Yuchai Equipment Technology Co., Ltd Yuchai U20 mini excavator Improvements in Over 80 Details: Tailless Excavator U20 is a Yuchai ...
Yuchai YC80 small excavator
Yuchai YC80 small excavator Seller: Guangxi Yuchai Equipment Technology Co., Ltd Yuchai YC80 small excavator International brand engine It is equipped with Yanmar 4TNV98C natur...
Top Type Hydraulic Breaker
Top Type Hydraulic Breaker Seller: Guangxi Yuchai Equipment Technology Co., Ltd Top Type Hydraulic Breaker With the higher restriction of blasting control,hydraulic breakeris w...
S35-Electric Skid Steer Loader
S35-Electric Skid Steer Loader Seller: Guangxi Yuchai Equipment Technology Co., Ltd S35-Electric Skid Steer Loader Yuchai S35 Electric Skid Steer Loaderis compact and flexible, des...