.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

OCTREOTIDE
OCTREOTIDE Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti...
H3K4me1
H3K4me1 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
H3K36me3
H3K36me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
SHK TOXIN
SHK TOXIN Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig...
H3K4me2
H3K4me2 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
All supplier products

Same products

Cable Wire Recycling Production Line
Cable Wire Recycling Production Line Seller: Changzhou Optima Technology Co.,Ltd. Cable Wire Recycling Production Line 1000kg Copper Wire Recycling Machines: The biggest ca...
Small Cable Granulator and Separator
Small Cable Granulator and Separator Seller: Changzhou Optima Technology Co.,Ltd. Small Cable Granulator and Separator : Small shape,1 phase power,grind and separate copper f...
Turnkey service of  tire recycling
Turnkey service of tire recycling Seller: Changzhou Optima Technology Co.,Ltd. Turnkey service of tire recycling At , we specialize in manufacturing advanced tire recyclin...
Mobile Portable Tire Shredder
Mobile Portable Tire Shredder Seller: Changzhou Optima Technology Co.,Ltd. Mobile Portable Tire Shredder Mobile Portable Tire Shredder – A cost-effective soluti...
Aluminum wire rod rewinding machine
Aluminum wire rod rewinding machine Seller: Changzhou Optima Technology Co.,Ltd. Aluminum wire rod rewinding machine Basic Introduction 's is engineered with advanced Korea...