.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.


Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

KURTOXIN
KURTOXIN SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ...
PALMITOYL TETRAPEPTIDE 7
PALMITOYL TETRAPEPTIDE 7 Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
UB AMC
UB AMC UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U...
Ω AGATOXIN IVB
Ω AGATOXIN IVB P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI...
CALCISEPTINE
CALCISEPTINE Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ...
All supplier products

Same products

Micronized polypropylene wax for injection moulding
Micronized polypropylene wax for injection moulding Seller: Syntop chemical Co.,Ltd. The incorporation of polypropylene micronized wax into injection moulding processes delivers the ...
Drum Type Mobile Mixing Station
Drum Type Mobile Mixing Station Seller: Yousheng Machinery Equipment Co.,Ltd Drum Type Mobile Mixing Station Drum Type Mobile Mixing StationPortable Drum Concrete Batch Plan...
Washable Cheap 13.56Mhz 213 Nfc Mini Stickers 13.56 Mhz RFID Label Sticker Tag HF/UHF Tags Dry Inlay
Washable Cheap 13.56Mhz 213 Nfc Mini Stickers 13.56 Mhz RFID Label Sticker Tag HF/UHF Tags Dry Inlay Seller: XIUCHENG RFID Size:On request Material:PET, PVC,paper or customized Frequency:UHF/HF Printing:Thermal transf...
Micronized wax used for industrial paint processing
Micronized wax used for industrial paint processing Seller: Syntop chemical Co.,Ltd. Micronized wax is a vital functional additive in industrial paint processing, with primary functi...
Plant Growth Regulator Manufacturer
Plant Growth Regulator Manufacturer Seller: HEBEI LAIKE BIOTECH CO.LTD Plant Growth Regulator Manufacturer Plant Growth Regulator Manufacturer - Laike Biotech spec...