.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

PALMITOYL TRIPEPTIDE 1(PAL GHK)
PALMITOYL TRIPEPTIDE 1(PAL GHK) Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY...
ACETYL OCTAPEPTIDE 3/1(SNAP-8)
ACETYL OCTAPEPTIDE 3/1(SNAP-8) Acetyl octapeptide 31(SNAP-8) Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild...
PROTOXIN II
PROTOXIN II NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2...
H3K4me2
H3K4me2 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
PSALMOTOXIN 1
PSALMOTOXIN 1 ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ...
All supplier products

Same products

Toy flammability tester
Toy flammability tester Seller: Qinsun Instruments Co., Ltd The Toy burning tester is designed to determine the safety property (flammability) of equipment, ...
PCB circuit board manufacturer for computer component PCB assembly service
PCB circuit board manufacturer for computer component PCB assembly service Seller: Shenzhen STHL Electronics Co.,Ltd. SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished...
Full Automatic PCB Assembly for Industrial Automation Custom PCB Manufacture PCBA Service
Full Automatic PCB Assembly for Industrial Automation Custom PCB Manufacture PCBA Service Seller: Shenzhen STHL Electronics Co.,Ltd. SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished...
PCBA Assembly Factory Android Motherboard Products PCBA Printed Circuit Board PCB SMT Service
PCBA Assembly Factory Android Motherboard Products PCBA Printed Circuit Board PCB SMT Service Seller: Shenzhen STHL Electronics Co.,Ltd. SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished...
PCBA customize air conditioner inverter universal single side PCB control board PCB assembly
PCBA customize air conditioner inverter universal single side PCB control board PCB assembly Seller: Shenzhen STHL Electronics Co.,Ltd. SERVICES:electronic material procurement, PCB production, PCBA assembly, cable assembly, finished...