.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

PLECANATIDE
PLECANATIDE Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ...
H3K4me2
H3K4me2 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
MAMBALGIN 1
MAMBALGIN 1 ASIC1 channels, Mambalgin 1is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. ...
L CARNOSINE
L CARNOSINE LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i...
MODIFIED HISTONE
MODIFIED HISTONE As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f...
All supplier products

Same products

35L Liquid Nitrogen Container Cryogenic Dewar Transport Tank
35L Liquid Nitrogen Container Cryogenic Dewar Transport Tank Seller: Henan Tianchi Instrument & Equipment Co., Ltd. KGSQ liquid nitrogen tank is made of high-strength aviation aluminum. The tank body is well-made ...
Cryogenic Liquid Nitrogen Container Semen Dewar
Cryogenic Liquid Nitrogen Container Semen Dewar Seller: Henan Tianzhidao Biological Technology Co., Ltd. KGSQ liquid nitrogen tank is made of high-strength aviation aluminum. The tank body is well-made ...
HS 2311 Plastic Die Steel
HS 2311 Plastic Die Steel Seller: Jiangsu Hongsheng Heavy Industry Group Co.,Ltd There are steel equivalents of different materials in the market, including s136 steel equivalent...
HOT WORK DIE STEEL
HOT WORK DIE STEEL Seller: Jiangsu Hongsheng Heavy Industry Group Co.,Ltd As one of the die steel manufacturers, we supply high quality hot work die steelto meet the requi...
Forged Round Steel Bar
Forged Round Steel Bar Seller: Jiangsu Hongsheng Heavy Industry Group Co.,Ltd Forged steel round bar is made in cylindrical shape, which can be shaped in direct forging or re-...