.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

PLECANATIDE
PLECANATIDE Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ...
PALMITOYL TETRAPEPTIDE 7
PALMITOYL TETRAPEPTIDE 7 Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
H3K56AC
H3K56AC Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with acetylation K56 modification. SPECIFICATION OF H3K5...
SHK TOXIN
SHK TOXIN Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig...
NONAPEPTIDE 1
NONAPEPTIDE 1 Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
All supplier products

Same products

OEM  Car Parts Alternator for Toyota
OEM Car Parts Alternator for Toyota Seller: Foshan Bohua Auto Parts Co., Ltd Automobile alternator, which is the main power supply of the automobile, is driven by the engine....
OEM  Parts of Alternator in Car for Toyota
OEM Parts of Alternator in Car for Toyota Seller: Foshan Bohua Auto Parts Co., Ltd OEM Parts of Alternator in Carfor Toyota Automobile alternator, which is the main power supply ...
OEM  Alternator Wholesale for Toyota
OEM Alternator Wholesale for Toyota Seller: Foshan Bohua Auto Parts Co., Ltd Automobile alternator wholesale, which is the main power supply of the automobile, is driven by t...
OEM  Automotive Alternator Parts for Toyota
OEM Automotive Alternator Parts for Toyota Seller: Foshan Bohua Auto Parts Co., Ltd The OEM part number refers to automotive alternator partsspecifically designed for Toyota vehicl...
OEM  Auto Parts Alternator for Toyota
OEM Auto Parts Alternator for Toyota Seller: Foshan Bohua Auto Parts Co., Ltd Auto parts alternator, which is the main power supply of the automobile, is driven by the engine....