.

MARGATOXIN

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO.
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

PALMITOYL PENTAPEPTIDE 4
PALMITOYL PENTAPEPTIDE 4 Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
ACETYL HEXAPEPTIDE 3(ARGIRELINE)
ACETYL HEXAPEPTIDE 3(ARGIRELINE) ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas...
 AGATOXIN IVA
AGATOXIN IVA P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna...
PALMITOYL TETRAPEPTIDE 7
PALMITOYL TETRAPEPTIDE 7 Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
H3K36me3
H3K36me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
All supplier products

Same products

Bosnia and Herzegovina liquid nitrogen tank for laboratory KGSQ
Bosnia and Herzegovina liquid nitrogen tank for laboratory KGSQ Seller: Henan Tianzhidao Biological Technology Co., Ltd In laboratories, most commonly used liquid nitrogen tanks have large capacity, large diameter, an...
Tanzania sperm cell storage KGSQ ln2 vessel
Tanzania sperm cell storage KGSQ ln2 vessel Seller: Henan Tianzhidao Biological Technology Co., Ltd. In laboratories, most commonly used liquid nitrogen tanks have large capacity, large diameter, an...
Ebike Battery
Ebike Battery Seller: Shenzhen Worldpower Energy Storage Technology Co.,Ltd Custom Ebike Lithium Battery Manufacturer Elevate your electric biking experience with Worldpowe...
Battery Energy Storage Systems
Battery Energy Storage Systems Seller: Shenzhen Worldpower Energy Storage Technology Co.,Ltd Battery Energy Storage Systems (BESS) are cutting-edge technologies that store electrical energy ...
ETH Ethereum Jasminer X4 BRICK ASIC Miner
ETH Ethereum Jasminer X4 BRICK ASIC Miner Seller: Shenzhen Dovina Electronic Co.,Ltd Jasminer X4 Brick Review Jasminer x4 brick for salefrom Jasminer mining EtHash algorithm with a ...