Ω AGATOXIN IVB
P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1
SPECIFICATION OF Ω AGATOXIN IVB
CAT |
C1060-V |
CAS NO. |
|
Product Name |
ωagatoxin IVB |
Purity |
> 98% |
Form/State |
Lyophilized powder |
Solubility |
Water, or 0.9% NaCl solution |
Molecular weight |
5273 Da |
Molecular formula |
C215H337N65O70S10 |
Source |
Synthetic peptide |
Storage |
Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) |
APPLICATION OF Ω AGATOXIN IVB
ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels
As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more about modification of histones, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... | |
SEMAGLUTIDE AND IMPURITY | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which... | |
APETX2 | ASIC3 channels, APETx2 inhibits ASIC3 channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAS N0.: Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRY... | |
SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... | |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Похожие товары
Natamycin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon! Welcome to inquire and book! Proper storage of natamycin is crucial to ... | |
Natamycin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon! Welcome to inquire and book! Agriculture ·Occasionally used to p... | |
Natamycin 7681-93-8 | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon! Welcome to inquire and book! Medical Applications Natamycin is used as ... | |
Natamycin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon! Welcome to inquire and book! Food Industry Natamycin is widely used as ... | |
Natamycin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon!Welcome to inquire and book! Natamycin is a natural antifungal agent and... |