Ω AGATOXIN IVB
P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1
SPECIFICATION OF Ω AGATOXIN IVB
|
CAT |
C1060-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVB |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Water, or 0.9% NaCl solution |
|
Molecular weight |
5273 Da |
|
Molecular formula |
C215H337N65O70S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) |
APPLICATION OF Ω AGATOXIN IVB
ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels
As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more about modification of histones, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
 |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
 |
H3K9ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K9 modification. SPECIFICATION OF H... |
Похожие товары
 |
Mobil DTE 832 ISO VG 32 208L Combined Cycle Turbine Oils | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil DTE832and 846 aresuperior performance turbine oilsdesigned for use in steam turbines, gas t... |
 |
MOBILUX EP 0 16KG Lithium Complex Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | This extreme pressure Grease has an NLGI Grade0comes in a 5-gallon bucket and weighs 38.53lbs. It... |
 |
Nisin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin, a natural antimicrobial peptide, has various applications in the food industry due to its ... |
 |
Nisin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin is considered a natural preservative because it is derived from the fermentation of bacteri... |
 |
Nisin | Продавец: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin is a natural antimicrobial peptide produced by certain strains of the bacterium Lactococcus... |
