Ω AGATOXIN IVB
P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1
SPECIFICATION OF Ω AGATOXIN IVB
CAT |
C1060-V |
CAS NO. |
|
Product Name |
ωagatoxin IVB |
Purity |
> 98% |
Form/State |
Lyophilized powder |
Solubility |
Water, or 0.9% NaCl solution |
Molecular weight |
5273 Da |
Molecular formula |
C215H337N65O70S10 |
Source |
Synthetic peptide |
Storage |
Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) |
APPLICATION OF Ω AGATOXIN IVB
ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels
As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more about modification of histones, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... | |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... | |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... | |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... | |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
Похожие товары
The Ultimate Guide to Fluorescent Dye | Продавец: Axispharm | The Ultimate Guide to Fluorescent Dye Fluorescent dyes, also known as fluorophores, are compound... | |
KLUBER LECTRIC KR 44-102 1KG Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | NSK LR380G/PC 20PC,50PC/Carton NSK AS280G/PC 20PC,50PC/Carton NSK LG280G/PC 20PC,50PC/Carton N... | |
KLUBER ISOFLEX TOPAS NCA52 75G Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | “LUBE FS-2-7 700G” LUBE FS-2-4 400G LUBE FS-2-2 200G LUBE FS-1-7 700G LUBE MY-2-7... | |
mbbr media | Продавец: Hangzhou NIHAO Environmental Tech Co., Ltd | As a professional OEM factory and exporter of MBBR carriers, NIHAO MBBR carriers to many large en... | |
Kluber ISOFLEX TOPAS L 32CN 1KG Grease for Pick and Place Machine | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | NSK LR380G/PC 20PC,50PC/Carton NSK AS280G/PC 20PC,50PC/Carton NSK LG280G/PC 20PC,50PC/Carton N... |