Ω AGATOXIN IVB
P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1
SPECIFICATION OF Ω AGATOXIN IVB
|
CAT |
C1060-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVB |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Water, or 0.9% NaCl solution |
|
Molecular weight |
5273 Da |
|
Molecular formula |
C215H337N65O70S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) |
APPLICATION OF Ω AGATOXIN IVB
ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels
As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more about modification of histones, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
 |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
PEPTIDE PRODUCTS | Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
Похожие товары
 |
Procaine | Продавец: 862043 | CAS:59-46-1 |
 |
High Concentration Plastic Color Masterbatch Factory Direct Supply | Продавец: 861445 | We are a professional color masterbatch manufacturer with years of R&D experience in plastic ... |
 |
Acid Ink Blue G Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Ink Blue G Factory 【Application of Acid Ink Blue G 】 mainly used for making blue or ... |
 |
Acid Black ATT Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Black ATT Factory 【What’s Acid Black ATT】 is made of acid black 10B and acid o... |
 |
Acid Black 10B Factory | Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD | Acid Black 10B Factory is mainly suitable for dyeing and printing wool ,silk and nylon fabri... |
