.

Ω AGATOXIN IVB

P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1

SPECIFICATION OF Ω AGATOXIN IVB

CAT

C1060-V

CAS NO.

Product Name

ωagatoxin IVB

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Water, or 0.9% NaCl solution

Molecular weight

5273 Da

Molecular formula

C215H337N65O70S10

Source

Synthetic peptide

Storage

Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46)

APPLICATION OF Ω AGATOXIN IVB

ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels

As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.

If you want to know more about modification of histones, please visit our website.



Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

SPECIFICATION OF IBERIOTOXIN
SPECIFICATION OF IBERIOTOXIN CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph...
PROFESSIONAL PEPTIDE SUPPLIER
PROFESSIONAL PEPTIDE SUPPLIER PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so...
ACETYL TETRAPEPTIDE 5(EYESERYL)
ACETYL TETRAPEPTIDE 5(EYESERYL) Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE...
H3K79me2
H3K79me2 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
H3K36me3
H3K36me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
Все товары поставщика

Похожие товары

K11 Flexible Waterproof Coating
K11 Flexible Waterproof Coating Продавец: Fujian Ruisen New Materials Co., Ltd. In recent years, with the improvement of people's living standard, the living conditions of the r...
Insulator & Electric Series
Insulator & Electric Series Продавец: Fujian Ruisen New Materials Co., Ltd. As a professional porcelain insulator suppliersand ceramic insulator suppliers, we offer differen...
Hollow & Bushing Insulator
Hollow & Bushing Insulator Продавец: Fujian Ruisen New Materials Co., Ltd. We offer different kinds of hollow porcelain insulator& Bushing Insulator for Substation, suc...
High Voltage Insulator Coating Series
High Voltage Insulator Coating Series Продавец: Fujian Ruisen New Materials Co., Ltd. High Voltage Insulator Coatings(HVIC) is used on excessive voltage insulators to forestall flasho...
Epoxy Zinc-Rich Primer
Epoxy Zinc-Rich Primer Продавец: Fujian Ruisen New Materials Co., Ltd. Instructions of Epoxy Zinc-Rich Primer It is two components epoxy zinc-rich primer heavy corro...