Ω AGATOXIN IVB
P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1
SPECIFICATION OF Ω AGATOXIN IVB
|
CAT |
C1060-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVB |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Water, or 0.9% NaCl solution |
|
Molecular weight |
5273 Da |
|
Molecular formula |
C215H337N65O70S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) |
APPLICATION OF Ω AGATOXIN IVB
ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels
As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more about modification of histones, please visit our website.
Send product request
Other supplier products
 |
CALCICLUDINE | L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
H3K79me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... |
Same products
 |
Natamycin Bulk supply | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Proper storage of natamycin is crucial to ... |
 |
High quality Natamycin | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Agriculture ·Occasionally used to p... |
 |
Natamycin 7681-93-8 | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Medical Applications Natamycin is used as ... |
 |
Natamycin Manufacturer | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Food Industry Natamycin is widely used as ... |
 |
Natamycin Supplier | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！Welcome to inquire and book！ Natamycin is a natural antifungal agent and... |
