Ω AGATOXIN IVB
P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1
SPECIFICATION OF Ω AGATOXIN IVB
|
CAT |
C1060-V |
|
CAS NO. |
|
|
Product Name |
ωagatoxin IVB |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Water, or 0.9% NaCl solution |
|
Molecular weight |
5273 Da |
|
Molecular formula |
C215H337N65O70S10 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) |
APPLICATION OF Ω AGATOXIN IVB
ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels
As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.
If you want to know more about modification of histones, please visit our website.
Send product request
Other supplier products
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
KURTOXIN | SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ... |
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th... |
 |
H3K9ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K9 modification. SPECIFICATION OF H... |
Same products
 |
Kluberoil Lamora D 220 30ml Original Oil | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Our oils offer excellent lubricity also at low sliding speeds, enabling constant and precise feed... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Lubecorp part number 249250 is a 400ml bellows style cartridge often times used in autolube appli... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil grease 28is a high performance, antiwear grease. Available as a cartridge,2kgcan, 16kg pail... |
 |
Kluber Isoflex Topas NCA 5051 50ml Original Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | ISOFLEX TOPAS NCA 5051is a beige synthetic long homogeneous and short fiber. It consists of a syn... |
 |
CHRISTO-LUBE MCG 111 2-OZ Valve Seal Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Christo-Lube®MCG 111is a fully fluorinated grease thickened with PTFE which operates under ex... |
