Ω AGATOXIN IVB

P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1

SPECIFICATION OF Ω AGATOXIN IVB

CAT	C1060-V
CAS NO.
Product Name	ωagatoxin IVB
Purity	> 98%
Form/State	Lyophilized powder
Solubility	Water, or 0.9% NaCl solution
Molecular weight	5273 Da
Molecular formula	C215H337N65O70S10
Source	Synthetic peptide
Storage	Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions	Up to two weeks at 4°C or three months at -20°C.
Sequence	EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46)

APPLICATION OF Ω AGATOXIN IVB

ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels

As one of the professional custom peptide pharmaceutical companiesin China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.

If you want to know more about modification of histones, please visit our website.

Other supplier products

	SPECIFICATION OF MAMBALGIN 1	CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi...
	PLECANATIDE	Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ...
	PALMITOYL TETRAPEPTIDE 7	Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as...
	NONAPEPTIDE 1	Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
	PLTX II	SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate...

供应产品

Same products

	Epimedium Extract	卖方: Fruit Powder,Vegetable Powder	Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ...
	Pumpkin Powder	卖方: Fruit Powder,Vegetable Powder	Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ...
	Broccoli Powder	卖方: Fruit Powder,Vegetable Powder	Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who...
	Pomegranate Powder	卖方: Fruit Powder,Vegetable Powder	Product Name: Pomegranate PowderLatin Name: Punica granatum linn.Used Part: Fruit juiceAppearance...
	Orange Powder	卖方: Fruit Powder,Vegetable Powder	Product Name: Orange PowderLatin Name: Citrus sinensisUsed Part: Fruit juiceAppearance: Light yel...