PSALMOTOXIN 1
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide synthesis chinathat inhibits cation currents mediated by acid-sensing ion channels (ASIC).
More details of toxicological analysis, please visit our website.
Send product request
Other supplier products
| ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... | |
| H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... | |
| UB AMC | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U... | |
| H3K9ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K9 modification. SPECIFICATION OF H... | |
| H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
| UB AMC | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumar... | |
| SYN AKE | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimi... | |
| SHK TOXIN | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar ... | |
| SEMAGLUTIDE AND IMPURITY | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide ana... | |
| PSALMOTOXIN 1 | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (AS... |














