SHK TOXIN
Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.
SPECIFICATION OF SHK TOXIN
|
CAT |
K1010-V |
|
CAS NO. |
|
|
Product Name |
ShK Toxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4055 Da |
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds between Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32) |
APPLICATION OF SHK TOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.
Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and custom peptide librarysuppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biological technologycompanies, and scientific research institute.
Send product request
Other supplier products
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PEPTIDE PRODUCTS | Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in... |
 |
OCTREOTIDE | Octreotideis a synthetic long-acting cyclic octapeptide with pharmacologic properties mimicking those of the natural hormone somatostatin. Octreoti... |
Same products
 |
UB AMC | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumar... |
 |
SYN AKE | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimi... |
|
|
SHK TOXIN | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar ... |
 |
SEMAGLUTIDE AND IMPURITY | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide ana... |
 |
PSALMOTOXIN 1 | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (AS... |
