AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)
CAS N0.:
Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)
Puriy: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 5202 Da
Molecular formula: C217H360N68O60S10
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.
Send product request
Other supplier products
 |
PROFESSIONAL PEPTIDE SUPPLIER | PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so... |
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... |
