AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)
CAS N0.:
Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)
Puriy: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 5202 Da
Molecular formula: C217H360N68O60S10
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.
Send product request
Other supplier products
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
 |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... |
Same products
 |
Easy-cleaning Silicone-Modified Waterborne UV Resin | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d... |
 |
Water-based Soft-Touch Resin for Consumer Electronics | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve... |
 |
Conformal Coatings | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro... |
 |
Metalized & Laser Transfer coating | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ... |
 |
Hydrophilic coatings for Air Conditioner | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi... |
