AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)
CAS N0.:
Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)
Puriy: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 5202 Da
Molecular formula: C217H360N68O60S10
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.
Send product request
Other supplier products
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
 |
H3K9me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
Same products
 |
Natamycin Bulk supply | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Proper storage of natamycin is crucial to ... |
 |
High quality Natamycin | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Agriculture ·Occasionally used to p... |
 |
Natamycin 7681-93-8 | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Medical Applications Natamycin is used as ... |
 |
Natamycin Manufacturer | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Food Industry Natamycin is widely used as ... |
 |
Natamycin Supplier | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！Welcome to inquire and book！ Natamycin is a natural antifungal agent and... |
