.

AGATOXIN IVA

P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.

SPECIFICATION OF Ω AGATOXIN IVA

Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)

CAS N0.:

Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide,bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)

Puriy: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 5202 Da

Molecular formula: C217H360N68O60S10

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF Ω AGATOXIN IVA

ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).

Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

CALCISEPTINE
CALCISEPTINE Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ...
ACETYL TETRAPEPTIDE 5(EYESERYL)
ACETYL TETRAPEPTIDE 5(EYESERYL) Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE...
 AGATOXIN IVA
AGATOXIN IVA P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna...
PROFESSIONAL PEPTIDE SUPPLIER
PROFESSIONAL PEPTIDE SUPPLIER , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ...
ACETYL HEXAPEPTIDE 3(ARGIRELINE)
ACETYL HEXAPEPTIDE 3(ARGIRELINE) The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th...
All supplier products

Same products

Silazanes
Silazanes Seller: Nanjing SiSiB Silicones Co., Ltd SiSiB SILICONES is a worldwide leading manufacturer of silanes and silicones for over 30 years. ...
Silanes & Siloxanes
Silanes & Siloxanes Seller: Nanjing SiSiB Silicones Co., Ltd SiSiB SILICONES is a leader ofsilicone gel manufacturers, and hasbeen producing silane coupling a...
RTV-2 Moding Silicone Rubber
RTV-2 Moding Silicone Rubber Seller: Nanjing SiSiB Silicones Co., Ltd SiSiB RTV-2 is a two-part, room-temperature curing silicone rubbers designed for mold-making. Si...
PU Foam Silicone Stabilizer
PU Foam Silicone Stabilizer Seller: Nanjing SiSiB Silicones Co., Ltd SiSiB develops and manufactures a full line of high-qualitysilicone oil surfactantfor formulating...
POWSIL-59223
POWSIL-59223 Seller: Nanjing SiSiB Silicones Co., Ltd POWSIL-59223 is an innovative textile softener, especially designed to deliver a hydrophilic, vo...