AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)
CAS N0.:
Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)
Puriy: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 5202 Da
Molecular formula: C217H360N68O60S10
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.
Send product request
Other supplier products
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
 |
H3K56AC | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with acetylation K56 modification. SPECIFICATION OF H3K5... |
Same products
 |
Castrol Molub-Allloy Paste TA 1KG High temperature Lubricants | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | MOLUB-ALLOY™PASTE TAensures a good separating and sealing effect in high temperature and we... |
 |
Phenol Alkylation Plant | Seller: Hubei Sanli Fengxiang Technology Co., Ltd | Phenol Alkylation Plant Product Description Alkyl phenolis produced by the alkylation of phenol... |
 |
KYODO YUSHI PAREMAX SUPER 400G High Temperature Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KYODO YUSHIExtend Lubrication Life RMS-4VRare Max SuperGrease Cartridge (400g) for Bearings |
 |
Mobil CHASSIS GREASE LBZ 16KG Exhibits Excellent Flow even at very low tempe Eatures and in Long Pipelines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil Chassis Grease LBZis a semi-fluidgreasebased on synthetic oils in the consistency group NLG... |
 |
Mobil Velocite Oil No 6 Spindle Oil 16KG | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | KLUBER ISOFLEX NBU15 KLUBER ISOFLEX NBU15 KLUBER ISOFLEX TOPAS NCA52 75G KLUBER ISOFLEX TOPAS ... |
