.

AGATOXIN IVA

P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.

SPECIFICATION OF Ω AGATOXIN IVA

Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)

CAS N0.:

Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide,bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)

Puriy: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 5202 Da

Molecular formula: C217H360N68O60S10

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF Ω AGATOXIN IVA

ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).

Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

PSALMOTOXIN 1
PSALMOTOXIN 1 ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ...
H3K4ME1
H3K4ME1 Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ...
PROTOXIN II
PROTOXIN II NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2...
L CARNOSINE
L CARNOSINE LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i...
PROTOXIN II
PROTOXIN II NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2...
Все товары поставщика

Похожие товары

Procaine
Procaine Продавец: 862043 CAS:59-46-1
High Concentration Plastic Color Masterbatch Factory Direct Supply
High Concentration Plastic Color Masterbatch Factory Direct Supply Продавец: 861445 We are a professional color masterbatch manufacturer with years of R&D experience in plastic ...
Acid Ink Blue G Factory
Acid Ink Blue G Factory Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD Acid Ink Blue G Factory 【Application of Acid Ink Blue G 】 mainly used for making blue or ...
Acid Black ATT Factory
Acid Black ATT Factory Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD Acid Black ATT Factory 【What’s Acid Black ATT】 is made of acid black 10B and acid o...
Acid Black 10B Factory
Acid Black 10B Factory Продавец: TIANJIN LEADING IMPORT & EXPORT CO., LTD Acid Black 10B Factory is mainly suitable for dyeing and printing wool ,silk and nylon fabri...