AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)
CAS N0.:
Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)
Puriy: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 5202 Da
Molecular formula: C217H360N68O60S10
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
SHK TOXIN | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold hig... |
 |
MODIFIED HISTONE | As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
H3K56ac | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
ACETYL HEXAPEPTIDE 3(ARGIRELINE) | ACETYL HEXAPEPTIDE 3ARGIRELINE The acetyl peptidereduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a proteas... |
Похожие товары
 |
Kluberoil Lamora D 220 30ml Original Oil | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | LAMORA Doils are used for the lubrication of slideways and guideways in modern machining centres,... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | TheLUBE SH-ONE-4Sis a special ureagreasedesigned for appropriatelubricationmanagement of machine ... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobilgrease 28resists water washing, provides superior load-carrying ability, reduces frictional ... |
 |
Kluber Isoflex Topas NCA 5051 50ml Original Lubricants | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | ISOFLEX TOPAS NCA 5051has a wide temperature range, is resistant to ageing and provides special c... |
 |
CHRISTO-LUBE MCG 111 2-OZ Valve Seal Grease | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Non-reactive lubricant safe for aviation oxygen equipment. Great for use on O-Rings |
