AGATOXIN IVA

• 

P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.

SPECIFICATION OF Ω AGATOXIN IVA

Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)

CAS N0.:

Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)

Puriy: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 5202 Da

Molecular formula: C217H360N68O60S10

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF Ω AGATOXIN IVA

ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).

Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.

Другие товары поставщика

	PALMITOYL PENTAPEPTIDE 4	Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
	APETX2	ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ...
	TYPES OF PEPTIDES FOR SALE	Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ...
	NONAPEPTIDE 1	Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
	PALMITOYL PENTAPEPTIDE 4	Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...

Похожие товары

	Easy-cleaning Silicone-Modified Waterborne UV Resin	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d...
	Water-based Soft-Touch Resin for Consumer Electronics	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve...
	Conformal Coatings	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro...
	Metalized & Laser Transfer coating	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ...
	Hydrophilic coatings for Air Conditioner	Продавец: Guangzhou Human New Material Science and Technology Co., Ltd	A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi...