AGATOXIN IVA
P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
SPECIFICATION OF Ω AGATOXIN IVA
Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)
CAS N0.:
Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide，bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)
Puriy: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 5202 Da
Molecular formula: C217H360N68O60S10
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF Ω AGATOXIN IVA
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
H3K36me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
