.

AGATOXIN IVA

P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.

SPECIFICATION OF Ω AGATOXIN IVA

Product Name: ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)

CAS N0.:

Sequence:KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide,bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)

Puriy: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 5202 Da

Molecular formula: C217H360N68O60S10

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF Ω AGATOXIN IVA

ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).

Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is one of thereputable peptide companiesthat integrates the scientific research, production, and sales of different types of peptides and custom peptidessynthesisservices in China. We currently have two R&D centers respectively in Hefei and Suzhou, with a comprehensive range of advanced equipment for drug R&D.


Отправить запрос, связаться с поставщиком

Кому: Hefei KS-V Peptide Biological Technology Co., Ltd.
Ваш E-mail:
Текст письма:


Send to other suppliers

Другие товары поставщика

PALMITOYL TRIPEPTIDE 1(PAL GHK)
PALMITOYL TRIPEPTIDE 1(PAL GHK) Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY...
H3K4me2
H3K4me2 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
CALCICLUDINE
CALCICLUDINE L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam...
H3K4me1
H3K4me1 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
H3K36me3
H3K36me3 As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
Все товары поставщика

Похожие товары

Trimellitic anhydride 97%
Trimellitic anhydride 97% Продавец: Yufeng International Group Co., Ltd Trimellitic anhydrideis a 2-benzofuran compound having oxo groups at the 1- and 3-positions and a...
Isobutyric Anhydride CAS 97-72-3
Isobutyric Anhydride CAS 97-72-3 Продавец: Yufeng International Group Co., Ltd Product Name: Isobutyric Anhydride CAS No.: 97-72-3 Purity: 99% Molecular Formula: C6H10O3 Mo...
Isobutyric Acid CAS 79-31-2
Isobutyric Acid CAS 79-31-2 Продавец: Yufeng International Group Co., Ltd Product Name:ISOBUTYRIC ACID Synonyms: 2-Methylpropanoic acid 79-31-2 Isobutanoic acid 2-Met...
2-Amino-2-methyl-1-propanol(AMP)CAS:124-68-5
2-Amino-2-methyl-1-propanol(AMP)CAS:124-68-5 Продавец: Yufeng International Group Co., Ltd AtYufeng, a trusted 2-Amino-2-methyl-1-propanol Factory & Supplier, we prioritize quality and...
Dimethyl sulfoxide (DMSO) CAS: 67-68-5
Dimethyl sulfoxide (DMSO) CAS: 67-68-5 Продавец: Yufeng International Group Co., Ltd Yufengis one of the leading dimethyl sulfoxide suppliers and also a professional such manufacture...