APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Send product request
Other supplier products
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
Ω AGATOXIN IVB | P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
Same products
 |
3-IN-ONE 100703 118ml Lubricates, cleans & Prevents Rust | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | The new3-in-One® multi-purpose oil with telescoping marksman spout comes in handy when precis... |
 |
LUBCON Thermoplex ALN 1001/00 50ml Oil Original New | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Lubcon THERMOPLEX ALN 1001/00is a synthetic semi-fluid gear grease can be used on ASM Siemens mac... |
 |
Kluberoil Lamora D 220 30ml Original Oil | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Our oils offer excellent lubricity also at low sliding speeds, enabling constant and precise feed... |
 |
LUBE SH-ONE-4S 400G for Fanuc Machines | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Lubecorp part number 249250 is a 400ml bellows style cartridge often times used in autolube appli... |
 |
Mobil Grease 28 Synthetic Aviation Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil grease 28is a high performance, antiwear grease. Available as a cartridge,2kgcan, 16kg pail... |
