.

APETX2

ASIC3 channels, APETx2 inhibits ASIC3 channels1

SPECIFICATION OF APETX2

Product Name: APETx2

CAS N0.:

Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)

Purity: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 4561 Da

Molecular formula: C196H280N54O61S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF APETX2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.

More information about our peptide synthetic route, contact us.



Send product request

To: Hefei KS-V Peptide Biological Technology Co., Ltd.
Your E-mail:
Message text:


Send to other suppliers

Other supplier products

PROFESSIONAL PEPTIDE SUPPLIER
PROFESSIONAL PEPTIDE SUPPLIER , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ...
 AGATOXIN IVA
AGATOXIN IVA P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna...
ACETYL OCTAPEPTIDE 3/1(SNAP-8)
ACETYL OCTAPEPTIDE 3/1(SNAP-8) Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar...
ACETYL HEXAPEPTIDE 3(ARGIRELINE)
ACETYL HEXAPEPTIDE 3(ARGIRELINE) The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th...
CALCISEPTINE
CALCISEPTINE Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ...
All supplier products

Same products

Testosterone Propionate powder
Testosterone Propionate powder Seller: Wuhan Demeikai Biotechnology Co., Ltd Chemical name: Testosterone propionate Alias: Testoviron;sterandryl;Agovirin;Testosteron Purity :...
Testosterone Cypionate powder
Testosterone Cypionate powder Seller: Wuhan Demeikai Biotechnology Co., Ltd CAS NO.:58-20-8 EINECS: 200-368-4 Assay: 99% min. Molecular Formula: C27H40O3 Molecular Weight: 4...
Testosterone Enanthate powder
Testosterone Enanthate powder Seller: Wuhan Demeikai Biotechnology Co., Ltd Name: Testosterone Enanthate Other common names and terms: Test E CAS number: 315-37-7 MF: C26H40...
GW0742 powder
GW0742 powder Seller: Wuhan Demeikai Biotechnology Co., Ltd Name: GW0742Other names: GW610742CAS#: Molecular formula: C21H17F4NO3S2Molecular weight: 471.488D...
SR9011 powder
SR9011 powder Seller: Wuhan Demeikai Biotechnology Co., Ltd Product Name: SR9011 Other name:Stenabolic CAS: Grade: Pharmaceutical grade Molecular formular: ...