APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Send product request
Other supplier products
 |
PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
 |
H3K56ac | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PEPTIDE PRODUCTS | Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology Co., Ltd. has a number of in... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
Same products
 |
Hot Melt Adhesive for Vacuum Insulation Panels | Seller: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Vacuum Insulation Panels Supply & Technical Support Capabilities ... |
 |
Hot Melt Adhesive for Packaging | Seller: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Packaging Bond Strength & Durability: Hot melt adhesives provide i... |
 |
Hot Melt Adhesive for Hygiene Products | Seller: Foshan Rurga New Material Technology Co. ,Ltd | Hot Melt Adhesive for Hygiene Products refers to thermoplastic pressure‑sensitive adhesives ... |
 |
LSAW Steel Pipe & Tube | Seller: HEBEI TIRICO PIPELINE CO.,LTD | LSAW Steel Pipe & Tube , or Longitudinal Submerged Arc-Welding Pipe (also known as SAWL ... |
 |
Anti-Corrosion Steel Pipe & Tube | Seller: HEBEI TIRICO PIPELINE CO.,LTD | Anti-Corrosion Steel Pipe & Tube Anti-Corrosion Steel Pipe & Tube What Is an Anti... |
