APETX2

• 

ASIC3 channels, APETx2 inhibits ASIC3 channels1

SPECIFICATION OF APETX2

Product Name: APETx2

CAS N0.:

Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)

Purity: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 4561 Da

Molecular formula: C196H280N54O61S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF APETX2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.

More information about our peptide synthetic route, contact us.

Other supplier products

	NONAPEPTIDE 1	Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ...
	H3K9me2	As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis...
	PALMITOYL PENTAPEPTIDE 4	Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib...
	ACETYL OCTAPEPTIDE 3/1(SNAP-8)	Acetyl octapeptide 31(SNAP-8) Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild...
	MODIFIED HISTONE	As a professional peptide companyin China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, f...

Same products

	Heat Sealing Sterilization Pouch	Seller: Hopeway AMD	Heat Sealing Sterilization Pouch is designed for secure medical instrument packaging, supporting ...
	Catalytic Converter Scrap Supplier, Catalytic Converter Scrap for Sale, , Catalytic Converter Scrap, Catalytic Scrap for Sale, Catalytic Scrap Supplier, Scrap Catalytic Supplier	Seller: Trucont LLC	At Trucont LLC, we have ongoing Catalytic converter scrap available for immediate loading and shi...
	Epimedium Extract	Seller: Xi'an Yuensun Biological Technology Co., Ltd.	Product Name: Epimedium ExtractLatin Name: Epimedium Sagittatum Maxim.Specification: Icariin 5%, ...
	Pumpkin Powder	Seller: Xi'an Yuensun Biological Technology Co., Ltd.	Product Name: Pumpkin PowderLatin Name: Cucurbita pepo L.Used Part: FruitAppearance: yellow fine ...
	Broccoli Powder	Seller: Xi'an Yuensun Biological Technology Co., Ltd.	Product Name: Broccoli powder Latin Name: Brassica oleracea L.var.italic Planch. Used Part: Who...