APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Send product request
Other supplier products
 |
H3K56ac | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild Botulinum toxin alternative ar... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
Same products
 |
Natamycin Bulk supply | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Proper storage of natamycin is crucial to ... |
 |
High quality Natamycin | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Agriculture ·Occasionally used to p... |
 |
Natamycin 7681-93-8 | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Medical Applications Natamycin is used as ... |
 |
Natamycin Manufacturer | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！ Welcome to inquire and book！ Food Industry Natamycin is widely used as ... |
 |
Natamycin Supplier | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | New products coming soon！Welcome to inquire and book！ Natamycin is a natural antifungal agent and... |
